Transcription Factor (TF) Information
| General Information of This TF | |||||
|---|---|---|---|---|---|
| TF ID |
TFD0331
|
||||
| TF name |
Zinc finger protein 263 (ZNF263)
|
||||
| Synonyms |
FPM315; ZKSCAN12; ZNF263; Zinc finger protein FPM315; Zinc finger protein with KRAB and SCAN domains 12
|
||||
| Gene Name |
ZNF263
|
||||
| Gene ID | |||||
| TF Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
| Class | C2H2 zinc finger factors | ||||
| Family | More than 3 adjacent zinc finger factors | ||||
| Subfamily | unclassified | ||||
| Function | This transcription factor binds to the consensus sequence 5'- TCCTCCC-3' and acts as a transcriptional repressor. | ||||
| Sequence | MASGPGSQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ RELGRLRQQVTNHGRGTEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQ RDPQAVKERALSAPWLSLFPPEGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRA LSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPSVQSCKEGLSPRGPAPGEEKF ENLEGVPSVCSENIHPQVLLPDQARGEVPWSPELGRPHDRSQGDWAPPPEGGMEQALAGA SSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDCTEIFGGNPR FLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLHRH QRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERTH ERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTGE KPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYK CSECGESFSRSSRLMSHQRTHTG |
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| JASPAR ID | |||||
| TF Binding Frequency Matrix |
|
||||
| Drug Transporter(s) Regulated by This TF | |||||
|---|---|---|---|---|---|
|
Direct binding |
|||||
|
ABCA1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
ABCA2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
ABCA3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
ABCA7 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
ABCB6 | Transporter Info |
ChIP sequencing in kidney | [1] | ||
|
ABCB8 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
ABCD1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
ABCG1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
AE2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
AE3 | Transporter Info |
ChIP sequencing in kidney | [2] | ||
|
AE4 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
ANT3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
ANXA11 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
ANXA2 | Transporter Info |
ChIP sequencing in kidney | [1] | ||
|
ARALAR1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
ARALAR2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
ASC1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
ASCT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
ASCT2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
ATP7B | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
BGT1 | Transporter Info |
ChIP sequencing in kidney | [1] | ||
|
CACNA1A | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
CACNA1C | Transporter Info |
ChIP sequencing in kidney | [2] | ||
|
CACNA1G | Transporter Info |
ChIP sequencing in kidney | [4] | ||
|
CACNB4 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
CACT | Transporter Info |
ChIP sequencing in kidney | [4] | ||
|
CRTR | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
CST | Transporter Info |
ChIP sequencing in kidney | [4] | ||
|
CTL1 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
CTL2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
CTL4 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
DIC | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
EAAT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
ENT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
ENT2 | Transporter Info |
ChIP sequencing in kidney | [1] | ||
|
ENT3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
ENT4 | Transporter Info |
ChIP sequencing in bone marrow; colon; kidney | [3] | ||
|
FATP1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
FLOT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
FUCT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
G3PP | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
G6PT | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
GAT2 | Transporter Info |
ChIP sequencing in kidney | [2] | ||
|
GC1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
GLUT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
GLUT4 | Transporter Info |
ChIP sequencing in kidney | [2] | ||
|
GLUT5 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
GLUT6 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
GLUT8 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
GLYT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
KCC1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
KCC2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
KCC3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
KCNH2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
KCNJ11 | Transporter Info |
ChIP sequencing in kidney | [2] | ||
|
KCNK4 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
KCNMA1 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
KCNN1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
KCNQ1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
LAT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
LAT2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
LAT4 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
MATE1 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
MCPHA | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
MCT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
MCT10 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
MCT3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
MCT4 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
MCT6 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
MDU1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
MRP3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
MRP5 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
MRP7 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
NADC3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
NBCe2 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
NCC | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
NDCBE | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
NIS | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
NKCC1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
NPT2A | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
NPT2C | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
NTT4 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
OAT2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
OAT6 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
OATP2A1 | Transporter Info |
ChIP sequencing in kidney | [2] | ||
|
OATP2B1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
OATP3A1 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
OATP4A1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
OCT-3 | Transporter Info |
ChIP sequencing in kidney | [4] | ||
|
OCTN1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
OCTN2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
OGC | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
ORNT3 | Transporter Info |
ChIP sequencing in kidney | [2] | ||
|
OSTbeta | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
PAT3 | Transporter Info |
ChIP sequencing in kidney | [2] | ||
|
PCFT | Transporter Info |
ChIP sequencing in kidney | [1] | ||
|
PHT2 | Transporter Info |
ChIP sequencing in kidney | [4] | ||
|
PIT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
PIT2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
PMP34 | Transporter Info |
ChIP sequencing in kidney | [2] | ||
|
PROT | Transporter Info |
ChIP sequencing in kidney | [1] | ||
|
PTR4 | Transporter Info |
ChIP sequencing in kidney | [1] | ||
|
RALBP1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
RFVT2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SAT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
SCAMC1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
SCAMC2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SCAMC3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
SCN4A | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SGLT2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
SGLT5 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
SLC11A1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SLC16A11 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SLC16A13 | Transporter Info |
ChIP sequencing in kidney | [1] | ||
|
SLC16A14 | Transporter Info |
ChIP sequencing in kidney | [2] | ||
|
SLC22A17 | Transporter Info |
ChIP sequencing in kidney | [2] | ||
|
SLC22A23 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SLC23A3 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
SLC24A1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SLC25A1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
SLC25A28 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
SLC25A33 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
SLC25A37 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SLC25A4 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
SLC25A42 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
SLC25A5 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
SLC26A2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
SLC26A6 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
SLC27A3 | Transporter Info |
ChIP sequencing in kidney | [1] | ||
|
SLC27A4 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
SLC27A5 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
SLC2A11 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
SLC2A9 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
SLC35A2 | Transporter Info |
ChIP sequencing in kidney | [1] | ||
|
SLC35A3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
SLC35A4 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
SLC35B2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SLC35B4 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
SLC35D2 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
SLC35E4 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SLC35F6 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
SLC37A2 | Transporter Info |
ChIP sequencing in kidney | [4] | ||
|
SLC37A3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
SLC38A10 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SLC38A9 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
SLC41A1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SLC41A2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
SLC45A1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
SLC45A3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
SLC45A4 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SLC48A1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
SLC4A1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
SLC4A11 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SLC50A1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
SLC7A6 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
SLC7A7 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
SLC8A1 | Transporter Info |
ChIP sequencing in kidney | [1] | ||
|
SLC8A2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
SLC8B1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
SLC9A1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SLC9A2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
SLC9A3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
SLC9A5 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
SLC9A7 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SLC9A8 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
SMVT | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SNAT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
SNAT2 | Transporter Info |
ChIP sequencing in kidney | [1] | ||
|
SNAT3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
SNAT6 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
SNAT7 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
SUR1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
SUT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
SVCT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
TAPL | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
TAUT | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
VGLUT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
VMAT1 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
ZIP1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
ZIP11 | Transporter Info |
ChIP sequencing in kidney | [3] | ||
|
ZIP13 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
ZIP14 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
ZIP2 | Transporter Info |
ChIP sequencing in kidney | [2] | ||
|
ZIP3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
ZIP4 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
ZIP5 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
|
ZIP7 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [2] | ||
|
ZNT1 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [3] | ||
|
ZNT2 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [4] | ||
|
ZNT3 | Transporter Info |
ChIP sequencing in bone marrow; kidney | [1] | ||
| Disease-specific Protein Abundances of TF | |||||
|---|---|---|---|---|---|