General Information of This TF
TF ID
TFD0225
TF name
Protein C-ets-2 (ETS2)
Synonyms
ETS2
Gene Name
ETS2
Gene ID
2114
TF Classification Superclass Helix-turn-helix domains
Class Tryptophan cluster factors
Family Ets-related factors
Subfamily Ets-like factors
Function This transcription factor activates transcription by binding specifically to the DNA GGAA/T core motif (Ets binding site or EBS) in the gene promoter.
Sequence
MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSIS
HDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATN
EFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEE
NSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFP
KSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQS
SLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRG
LRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED
Uniprot ID
ETS2_HUMAN
Ensembl ID
ENSG00000157557
HGNC ID
HGNC:3489
JASPAR ID
MA1484.1
TF Binding Frequency Matrix TFD0225
Drug Transporter(s) Regulated by This TF

Direct binding

ABCB8

Transporter Info

ChIP sequencing in colon

[1]

ABCD3

Transporter Info

ChIP sequencing in colon

[2]

AE2

Transporter Info

ChIP sequencing in colon

[3]

ARALAR1

Transporter Info

ChIP sequencing in colon

[3]

ARALAR2

Transporter Info

ChIP sequencing in colon

[2]

ASCT2

Transporter Info

ChIP sequencing in colon

[3]

AST

Transporter Info

ChIP sequencing in colon

[2]

CST

Transporter Info

ChIP sequencing in colon

[3]

ENT2

Transporter Info

ChIP sequencing in colon

[4]

FLOT1

Transporter Info

ChIP sequencing in colon

[1]

FUCT1

Transporter Info

ChIP sequencing in colon

[4]

G6PT

Transporter Info

ChIP sequencing in colon

[1]

KCC3

Transporter Info

ChIP sequencing in colon

[1]

MCPHA

Transporter Info

ChIP sequencing in colon

[4]

MCT6

Transporter Info

ChIP sequencing in colon

[3]

MRP3

Transporter Info

ChIP sequencing in colon

[2]

MRP5

Transporter Info

ChIP sequencing in colon

[4]

NPT2A

Transporter Info

ChIP sequencing in colon

[1]

NRAMP2

Transporter Info

ChIP sequencing in colon

[4]

OCTN1

Transporter Info

ChIP sequencing in colon

[4]

PHC

Transporter Info

ChIP sequencing in colon

[4]

PIT1

Transporter Info

ChIP sequencing in colon

[2]

RALBP1

Transporter Info

ChIP sequencing in colon

[1]

SAMC

Transporter Info

ChIP sequencing in colon

[2]

SCAMC1

Transporter Info

ChIP sequencing in colon

[3]

SCAMC3

Transporter Info

ChIP sequencing in colon

[1]

SLC25A1

Transporter Info

ChIP sequencing in colon

[1]

SLC25A38

Transporter Info

ChIP sequencing in colon

[1]

SLC27A4

Transporter Info

ChIP sequencing in colon

[3]

SLC27A5

Transporter Info

ChIP sequencing in colon

[2]

SLC35A3

Transporter Info

ChIP sequencing in colon

[2]

SLC41A2

Transporter Info

ChIP sequencing in colon

[1]

SLC7A6

Transporter Info

ChIP sequencing in colon

[4]

SMVT

Transporter Info

ChIP sequencing in colon

[2]

TAPL

Transporter Info

ChIP sequencing in colon

[3]

VGLUT1

Transporter Info

ChIP sequencing in colon

[4]

ZIP1

Transporter Info

ChIP sequencing in colon

[3]

ZIP14

Transporter Info

ChIP sequencing in colon

[2]

ZIP4

Transporter Info

ChIP sequencing in colon

[4]
Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.722820201; Fold-change:0.03538601; Z-score:0.076924959
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.083389221; Fold-change:-0.950382108; Z-score:-13.51617702
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.46729997; Fold-change:-0.128521021; Z-score:-0.191894681
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.33E-62; Fold-change:0.923102363; Z-score:2.091792909
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000858998; Fold-change:0.621394194; Z-score:1.12156492
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.012813991; Fold-change:0.249626113; Z-score:0.760049458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.71E-28; Fold-change:1.336653739; Z-score:2.851112952
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.722820201; Fold-change:0.03538601; Z-score:0.076924959
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.083389221; Fold-change:-0.950382108; Z-score:-13.51617702
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.46729997; Fold-change:-0.128521021; Z-score:-0.191894681
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.33E-62; Fold-change:0.923102363; Z-score:2.091792909
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000858998; Fold-change:0.621394194; Z-score:1.12156492
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.012813991; Fold-change:0.249626113; Z-score:0.760049458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.71E-28; Fold-change:1.336653739; Z-score:2.851112952
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.722820201; Fold-change:0.03538601; Z-score:0.076924959
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.083389221; Fold-change:-0.950382108; Z-score:-13.51617702
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.46729997; Fold-change:-0.128521021; Z-score:-0.191894681
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.33E-62; Fold-change:0.923102363; Z-score:2.091792909
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000858998; Fold-change:0.621394194; Z-score:1.12156492
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.012813991; Fold-change:0.249626113; Z-score:0.760049458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.71E-28; Fold-change:1.336653739; Z-score:2.851112952
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.722820201; Fold-change:0.03538601; Z-score:0.076924959
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.083389221; Fold-change:-0.950382108; Z-score:-13.51617702
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.46729997; Fold-change:-0.128521021; Z-score:-0.191894681
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.33E-62; Fold-change:0.923102363; Z-score:2.091792909
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000858998; Fold-change:0.621394194; Z-score:1.12156492
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.012813991; Fold-change:0.249626113; Z-score:0.760049458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.71E-28; Fold-change:1.336653739; Z-score:2.851112952
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.722820201; Fold-change:0.03538601; Z-score:0.076924959
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.083389221; Fold-change:-0.950382108; Z-score:-13.51617702
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.46729997; Fold-change:-0.128521021; Z-score:-0.191894681
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.33E-62; Fold-change:0.923102363; Z-score:2.091792909
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000858998; Fold-change:0.621394194; Z-score:1.12156492
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.012813991; Fold-change:0.249626113; Z-score:0.760049458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.71E-28; Fold-change:1.336653739; Z-score:2.851112952
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.722820201; Fold-change:0.03538601; Z-score:0.076924959
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.083389221; Fold-change:-0.950382108; Z-score:-13.51617702
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.46729997; Fold-change:-0.128521021; Z-score:-0.191894681
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.33E-62; Fold-change:0.923102363; Z-score:2.091792909
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000858998; Fold-change:0.621394194; Z-score:1.12156492
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.012813991; Fold-change:0.249626113; Z-score:0.760049458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.71E-28; Fold-change:1.336653739; Z-score:2.851112952
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.722820201; Fold-change:0.03538601; Z-score:0.076924959
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.083389221; Fold-change:-0.950382108; Z-score:-13.51617702
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.46729997; Fold-change:-0.128521021; Z-score:-0.191894681
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.33E-62; Fold-change:0.923102363; Z-score:2.091792909
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000858998; Fold-change:0.621394194; Z-score:1.12156492
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.012813991; Fold-change:0.249626113; Z-score:0.760049458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.71E-28; Fold-change:1.336653739; Z-score:2.851112952
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.73E-42; Fold-change:-0.623493579; Z-score:-0.868815584
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.532488999; Fold-change:0.509155831; Z-score:0.861459756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.623641979; Fold-change:-0.413854477; Z-score:-0.371499781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435470305; Fold-change:0.06928219; Z-score:0.109333088
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.85E-05; Fold-change:-0.243383144; Z-score:-0.98324455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.353214123; Fold-change:0.031314018; Z-score:0.125634413
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.09841844; Fold-change:-0.164083643; Z-score:-0.299145485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.004342982; Fold-change:2.450248175; Z-score:3.94792348
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.8301575; Fold-change:0.028154755; Z-score:0.083388214
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.210871428; Fold-change:-0.100903397; Z-score:-0.278292019
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.16385588; Fold-change:-0.140672452; Z-score:-0.309041928
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.01E-28; Fold-change:1.13433242; Z-score:1.37805744
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004700339; Fold-change:0.482456595; Z-score:0.507454439
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.375538096; Fold-change:-0.163816739; Z-score:-0.198021346
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.02050294; Fold-change:-0.557394246; Z-score:-1.076314658
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035390302; Fold-change:0.664585711; Z-score:2.650649251
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002534218; Fold-change:0.438759492; Z-score:0.769677859
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.12E-53; Fold-change:0.932696939; Z-score:2.017868633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.44E-29; Fold-change:1.086520573; Z-score:1.517096952
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.041246439; Fold-change:1.033660188; Z-score:1.853340137
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.028863987; Fold-change:0.647903236; Z-score:1.774608511
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.032692447; Fold-change:0.445529261; Z-score:0.593088127
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000586012; Fold-change:0.934466353; Z-score:0.766259461
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000362963; Fold-change:-0.693807669; Z-score:-0.832614574
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.89E-33; Fold-change:-0.934132228; Z-score:-1.366547265
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.056031134; Fold-change:-1.27920442; Z-score:-1.625110766
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.89E-40; Fold-change:-0.797043294; Z-score:-1.373689279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.96E-27; Fold-change:-1.051652311; Z-score:-1.487524226
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.600795829; Fold-change:0.030670512; Z-score:0.025712175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.00E-59; Fold-change:-1.575903465; Z-score:-2.003831692
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.12E-22; Fold-change:-0.857269338; Z-score:-1.366288597
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.20E-23; Fold-change:-0.346858337; Z-score:-0.635753254
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.26E-07; Fold-change:-0.697007009; Z-score:-0.804450223
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435187902; Fold-change:-0.537703626; Z-score:-0.566025303
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.27953168; Fold-change:-0.035809571; Z-score:-0.085674901
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.27E-05; Fold-change:0.738668585; Z-score:1.064995673
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.866260353; Fold-change:-0.100333274; Z-score:-0.141297733
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.009023358; Fold-change:-1.159747259; Z-score:-2.581473339
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002884224; Fold-change:-0.523803371; Z-score:-0.546425094
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049024966; Fold-change:0.668516641; Z-score:0.956596252
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001371555; Fold-change:0.386125855; Z-score:0.737527315
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.280151183; Fold-change:0.114639254; Z-score:0.465555595
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.89E-07; Fold-change:-0.492178278; Z-score:-3.028058613
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.46E-09; Fold-change:2.18074607; Z-score:8.987411788
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.285653144; Fold-change:0.13651355; Z-score:0.265664274
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.069525101; Fold-change:-0.117139157; Z-score:-0.167754855
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:3.55E-07; Fold-change:-0.426079092; Z-score:-1.438735022
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-2.079749446; Z-score:-2.431113194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.34E-08; Fold-change:-2.078033807; Z-score:-3.850280147
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.07E-27; Fold-change:0.982586408; Z-score:1.947473397
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.047616798; Fold-change:0.186823295; Z-score:0.684895037
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037190887; Fold-change:-1.051520403; Z-score:-2.287544728
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049926084; Fold-change:-0.125307255; Z-score:-0.524508462
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.504752592; Fold-change:0.406461822; Z-score:0.555745906
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.047616798; Fold-change:0.186823295; Z-score:0.684895037
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037190887; Fold-change:-1.051520403; Z-score:-2.287544728
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049926084; Fold-change:-0.125307255; Z-score:-0.524508462
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.504752592; Fold-change:0.406461822; Z-score:0.555745906
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.047616798; Fold-change:0.186823295; Z-score:0.684895037
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037190887; Fold-change:-1.051520403; Z-score:-2.287544728
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049926084; Fold-change:-0.125307255; Z-score:-0.524508462
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.504752592; Fold-change:0.406461822; Z-score:0.555745906
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.047616798; Fold-change:0.186823295; Z-score:0.684895037
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037190887; Fold-change:-1.051520403; Z-score:-2.287544728
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.049926084; Fold-change:-0.125307255; Z-score:-0.524508462
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.504752592; Fold-change:0.406461822; Z-score:0.555745906
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.181461151; Fold-change:-0.132453683; Z-score:-0.931117822
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000566237; Fold-change:0.184880136; Z-score:0.326984277
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.41704579; Fold-change:-0.037062316; Z-score:-0.161386475
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.617121681; Fold-change:0.097614708; Z-score:0.605023624
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.214320327; Fold-change:0.338896099; Z-score:1.765356878
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.359984108; Fold-change:-0.163145299; Z-score:-0.266186978
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.068706887; Fold-change:1.542255812; Z-score:1.390369875
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.181461151; Fold-change:-0.132453683; Z-score:-0.931117822
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000566237; Fold-change:0.184880136; Z-score:0.326984277
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.41704579; Fold-change:-0.037062316; Z-score:-0.161386475
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.617121681; Fold-change:0.097614708; Z-score:0.605023624
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.214320327; Fold-change:0.338896099; Z-score:1.765356878
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.359984108; Fold-change:-0.163145299; Z-score:-0.266186978
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.068706887; Fold-change:1.542255812; Z-score:1.390369875
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.181461151; Fold-change:-0.132453683; Z-score:-0.931117822
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000566237; Fold-change:0.184880136; Z-score:0.326984277
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.41704579; Fold-change:-0.037062316; Z-score:-0.161386475
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.617121681; Fold-change:0.097614708; Z-score:0.605023624
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.214320327; Fold-change:0.338896099; Z-score:1.765356878
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.359984108; Fold-change:-0.163145299; Z-score:-0.266186978
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.068706887; Fold-change:1.542255812; Z-score:1.390369875
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.181461151; Fold-change:-0.132453683; Z-score:-0.931117822
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000566237; Fold-change:0.184880136; Z-score:0.326984277
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.41704579; Fold-change:-0.037062316; Z-score:-0.161386475
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.617121681; Fold-change:0.097614708; Z-score:0.605023624
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.214320327; Fold-change:0.338896099; Z-score:1.765356878
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.359984108; Fold-change:-0.163145299; Z-score:-0.266186978
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.068706887; Fold-change:1.542255812; Z-score:1.390369875
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.181461151; Fold-change:-0.132453683; Z-score:-0.931117822
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000566237; Fold-change:0.184880136; Z-score:0.326984277
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.41704579; Fold-change:-0.037062316; Z-score:-0.161386475
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.617121681; Fold-change:0.097614708; Z-score:0.605023624
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.214320327; Fold-change:0.338896099; Z-score:1.765356878
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.359984108; Fold-change:-0.163145299; Z-score:-0.266186978
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.068706887; Fold-change:1.542255812; Z-score:1.390369875
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.181461151; Fold-change:-0.132453683; Z-score:-0.931117822
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000566237; Fold-change:0.184880136; Z-score:0.326984277
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.41704579; Fold-change:-0.037062316; Z-score:-0.161386475
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.617121681; Fold-change:0.097614708; Z-score:0.605023624
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.214320327; Fold-change:0.338896099; Z-score:1.765356878
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.359984108; Fold-change:-0.163145299; Z-score:-0.266186978
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.068706887; Fold-change:1.542255812; Z-score:1.390369875
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.74311742; Fold-change:-0.245627486; Z-score:-0.357950867
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.139605769; Fold-change:0.019446925; Z-score:0.096824497
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.630325092; Fold-change:-0.391730237; Z-score:-0.856005343
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.501926617; Fold-change:0.075339043; Z-score:0.262286712
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.010846404; Fold-change:0.603306873; Z-score:1.61026942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.452098102; Fold-change:0.007615399; Z-score:0.033630711
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.567317206; Fold-change:-0.009093734; Z-score:-0.047996304
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.01E-06; Fold-change:1.172422783; Z-score:1.662292887
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.74311742; Fold-change:-0.245627486; Z-score:-0.357950867
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.139605769; Fold-change:0.019446925; Z-score:0.096824497
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.630325092; Fold-change:-0.391730237; Z-score:-0.856005343
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.501926617; Fold-change:0.075339043; Z-score:0.262286712
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.010846404; Fold-change:0.603306873; Z-score:1.61026942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.452098102; Fold-change:0.007615399; Z-score:0.033630711
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.567317206; Fold-change:-0.009093734; Z-score:-0.047996304
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.01E-06; Fold-change:1.172422783; Z-score:1.662292887
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.74311742; Fold-change:-0.245627486; Z-score:-0.357950867
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.139605769; Fold-change:0.019446925; Z-score:0.096824497
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.630325092; Fold-change:-0.391730237; Z-score:-0.856005343
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.501926617; Fold-change:0.075339043; Z-score:0.262286712
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.010846404; Fold-change:0.603306873; Z-score:1.61026942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.452098102; Fold-change:0.007615399; Z-score:0.033630711
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.567317206; Fold-change:-0.009093734; Z-score:-0.047996304
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.01E-06; Fold-change:1.172422783; Z-score:1.662292887
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.74311742; Fold-change:-0.245627486; Z-score:-0.357950867
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.139605769; Fold-change:0.019446925; Z-score:0.096824497
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.630325092; Fold-change:-0.391730237; Z-score:-0.856005343
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.501926617; Fold-change:0.075339043; Z-score:0.262286712
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.010846404; Fold-change:0.603306873; Z-score:1.61026942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.452098102; Fold-change:0.007615399; Z-score:0.033630711
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.567317206; Fold-change:-0.009093734; Z-score:-0.047996304
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.01E-06; Fold-change:1.172422783; Z-score:1.662292887
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.74311742; Fold-change:-0.245627486; Z-score:-0.357950867
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.139605769; Fold-change:0.019446925; Z-score:0.096824497
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.630325092; Fold-change:-0.391730237; Z-score:-0.856005343
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.501926617; Fold-change:0.075339043; Z-score:0.262286712
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.010846404; Fold-change:0.603306873; Z-score:1.61026942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.452098102; Fold-change:0.007615399; Z-score:0.033630711
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.567317206; Fold-change:-0.009093734; Z-score:-0.047996304
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.01E-06; Fold-change:1.172422783; Z-score:1.662292887
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.74311742; Fold-change:-0.245627486; Z-score:-0.357950867
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.139605769; Fold-change:0.019446925; Z-score:0.096824497
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.630325092; Fold-change:-0.391730237; Z-score:-0.856005343
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.501926617; Fold-change:0.075339043; Z-score:0.262286712
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.010846404; Fold-change:0.603306873; Z-score:1.61026942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.452098102; Fold-change:0.007615399; Z-score:0.033630711
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.567317206; Fold-change:-0.009093734; Z-score:-0.047996304
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.01E-06; Fold-change:1.172422783; Z-score:1.662292887
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.74311742; Fold-change:-0.245627486; Z-score:-0.357950867
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.139605769; Fold-change:0.019446925; Z-score:0.096824497
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.630325092; Fold-change:-0.391730237; Z-score:-0.856005343
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.501926617; Fold-change:0.075339043; Z-score:0.262286712
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.010846404; Fold-change:0.603306873; Z-score:1.61026942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.452098102; Fold-change:0.007615399; Z-score:0.033630711
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.567317206; Fold-change:-0.009093734; Z-score:-0.047996304
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.01E-06; Fold-change:1.172422783; Z-score:1.662292887
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.101814777; Fold-change:0.006835068; Z-score:0.020517608
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.323384682; Fold-change:-0.098897213; Z-score:-0.234282864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.613057169; Fold-change:-0.022240159; Z-score:-0.079063155
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.677880465; Fold-change:-0.396056648; Z-score:-0.640241403
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.094491619; Fold-change:0.213964162; Z-score:0.418415319
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.76572906; Fold-change:-0.163468908; Z-score:-0.264297968
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.101814777; Fold-change:0.006835068; Z-score:0.020517608
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.323384682; Fold-change:-0.098897213; Z-score:-0.234282864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.613057169; Fold-change:-0.022240159; Z-score:-0.079063155
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.677880465; Fold-change:-0.396056648; Z-score:-0.640241403
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.094491619; Fold-change:0.213964162; Z-score:0.418415319
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.76572906; Fold-change:-0.163468908; Z-score:-0.264297968
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.101814777; Fold-change:0.006835068; Z-score:0.020517608
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.323384682; Fold-change:-0.098897213; Z-score:-0.234282864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.613057169; Fold-change:-0.022240159; Z-score:-0.079063155
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.677880465; Fold-change:-0.396056648; Z-score:-0.640241403
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.094491619; Fold-change:0.213964162; Z-score:0.418415319
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.76572906; Fold-change:-0.163468908; Z-score:-0.264297968
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.101814777; Fold-change:0.006835068; Z-score:0.020517608
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.323384682; Fold-change:-0.098897213; Z-score:-0.234282864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.613057169; Fold-change:-0.022240159; Z-score:-0.079063155
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.677880465; Fold-change:-0.396056648; Z-score:-0.640241403
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.094491619; Fold-change:0.213964162; Z-score:0.418415319
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.76572906; Fold-change:-0.163468908; Z-score:-0.264297968
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.101814777; Fold-change:0.006835068; Z-score:0.020517608
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.323384682; Fold-change:-0.098897213; Z-score:-0.234282864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.613057169; Fold-change:-0.022240159; Z-score:-0.079063155
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.677880465; Fold-change:-0.396056648; Z-score:-0.640241403
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.094491619; Fold-change:0.213964162; Z-score:0.418415319
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.76572906; Fold-change:-0.163468908; Z-score:-0.264297968
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.929145127; Fold-change:-0.259747006; Z-score:-0.543610537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036369543; Fold-change:0.557652552; Z-score:0.652987795
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.014702044; Fold-change:-0.187885051; Z-score:-0.346688458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.79154206; Fold-change:0.342220442; Z-score:0.406480276
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106486991; Fold-change:0.265855599; Z-score:0.901434942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.153207489; Fold-change:0.490462716; Z-score:0.760330712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.347126901; Fold-change:-0.257165635; Z-score:-0.367548017
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.717460394; Fold-change:0.039914914; Z-score:0.095817194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524276365; Fold-change:0.016695197; Z-score:0.015587826
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.007770253; Fold-change:0.293592783; Z-score:0.730056832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.314269503; Fold-change:0.324484114; Z-score:0.42932069
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.167811864; Fold-change:0.373491204; Z-score:2.259916288
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030261663; Fold-change:-0.448357774; Z-score:-0.969931741
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.715414342; Fold-change:0.318646174; Z-score:0.27210208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.144470562; Fold-change:0.442194062; Z-score:0.95848653
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.929145127; Fold-change:-0.259747006; Z-score:-0.543610537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036369543; Fold-change:0.557652552; Z-score:0.652987795
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.014702044; Fold-change:-0.187885051; Z-score:-0.346688458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.79154206; Fold-change:0.342220442; Z-score:0.406480276
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106486991; Fold-change:0.265855599; Z-score:0.901434942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.153207489; Fold-change:0.490462716; Z-score:0.760330712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.347126901; Fold-change:-0.257165635; Z-score:-0.367548017
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.717460394; Fold-change:0.039914914; Z-score:0.095817194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524276365; Fold-change:0.016695197; Z-score:0.015587826
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.007770253; Fold-change:0.293592783; Z-score:0.730056832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.314269503; Fold-change:0.324484114; Z-score:0.42932069
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.167811864; Fold-change:0.373491204; Z-score:2.259916288
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030261663; Fold-change:-0.448357774; Z-score:-0.969931741
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.715414342; Fold-change:0.318646174; Z-score:0.27210208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.144470562; Fold-change:0.442194062; Z-score:0.95848653
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.929145127; Fold-change:-0.259747006; Z-score:-0.543610537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036369543; Fold-change:0.557652552; Z-score:0.652987795
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.014702044; Fold-change:-0.187885051; Z-score:-0.346688458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.79154206; Fold-change:0.342220442; Z-score:0.406480276
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106486991; Fold-change:0.265855599; Z-score:0.901434942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.153207489; Fold-change:0.490462716; Z-score:0.760330712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.347126901; Fold-change:-0.257165635; Z-score:-0.367548017
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.717460394; Fold-change:0.039914914; Z-score:0.095817194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524276365; Fold-change:0.016695197; Z-score:0.015587826
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.007770253; Fold-change:0.293592783; Z-score:0.730056832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.314269503; Fold-change:0.324484114; Z-score:0.42932069
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.167811864; Fold-change:0.373491204; Z-score:2.259916288
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030261663; Fold-change:-0.448357774; Z-score:-0.969931741
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.715414342; Fold-change:0.318646174; Z-score:0.27210208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.144470562; Fold-change:0.442194062; Z-score:0.95848653
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.929145127; Fold-change:-0.259747006; Z-score:-0.543610537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036369543; Fold-change:0.557652552; Z-score:0.652987795
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.014702044; Fold-change:-0.187885051; Z-score:-0.346688458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.79154206; Fold-change:0.342220442; Z-score:0.406480276
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106486991; Fold-change:0.265855599; Z-score:0.901434942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.153207489; Fold-change:0.490462716; Z-score:0.760330712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.347126901; Fold-change:-0.257165635; Z-score:-0.367548017
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.717460394; Fold-change:0.039914914; Z-score:0.095817194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524276365; Fold-change:0.016695197; Z-score:0.015587826
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.007770253; Fold-change:0.293592783; Z-score:0.730056832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.314269503; Fold-change:0.324484114; Z-score:0.42932069
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.167811864; Fold-change:0.373491204; Z-score:2.259916288
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030261663; Fold-change:-0.448357774; Z-score:-0.969931741
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.715414342; Fold-change:0.318646174; Z-score:0.27210208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.144470562; Fold-change:0.442194062; Z-score:0.95848653
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.929145127; Fold-change:-0.259747006; Z-score:-0.543610537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036369543; Fold-change:0.557652552; Z-score:0.652987795
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.014702044; Fold-change:-0.187885051; Z-score:-0.346688458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.79154206; Fold-change:0.342220442; Z-score:0.406480276
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106486991; Fold-change:0.265855599; Z-score:0.901434942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.153207489; Fold-change:0.490462716; Z-score:0.760330712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.347126901; Fold-change:-0.257165635; Z-score:-0.367548017
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.717460394; Fold-change:0.039914914; Z-score:0.095817194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524276365; Fold-change:0.016695197; Z-score:0.015587826
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.007770253; Fold-change:0.293592783; Z-score:0.730056832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.314269503; Fold-change:0.324484114; Z-score:0.42932069
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.167811864; Fold-change:0.373491204; Z-score:2.259916288
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030261663; Fold-change:-0.448357774; Z-score:-0.969931741
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.715414342; Fold-change:0.318646174; Z-score:0.27210208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.144470562; Fold-change:0.442194062; Z-score:0.95848653
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.929145127; Fold-change:-0.259747006; Z-score:-0.543610537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036369543; Fold-change:0.557652552; Z-score:0.652987795
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.014702044; Fold-change:-0.187885051; Z-score:-0.346688458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.79154206; Fold-change:0.342220442; Z-score:0.406480276
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106486991; Fold-change:0.265855599; Z-score:0.901434942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.153207489; Fold-change:0.490462716; Z-score:0.760330712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.347126901; Fold-change:-0.257165635; Z-score:-0.367548017
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.717460394; Fold-change:0.039914914; Z-score:0.095817194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524276365; Fold-change:0.016695197; Z-score:0.015587826
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.007770253; Fold-change:0.293592783; Z-score:0.730056832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.314269503; Fold-change:0.324484114; Z-score:0.42932069
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.167811864; Fold-change:0.373491204; Z-score:2.259916288
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030261663; Fold-change:-0.448357774; Z-score:-0.969931741
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.715414342; Fold-change:0.318646174; Z-score:0.27210208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.144470562; Fold-change:0.442194062; Z-score:0.95848653
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.929145127; Fold-change:-0.259747006; Z-score:-0.543610537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036369543; Fold-change:0.557652552; Z-score:0.652987795
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.014702044; Fold-change:-0.187885051; Z-score:-0.346688458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.79154206; Fold-change:0.342220442; Z-score:0.406480276
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106486991; Fold-change:0.265855599; Z-score:0.901434942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.153207489; Fold-change:0.490462716; Z-score:0.760330712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.347126901; Fold-change:-0.257165635; Z-score:-0.367548017
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.717460394; Fold-change:0.039914914; Z-score:0.095817194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524276365; Fold-change:0.016695197; Z-score:0.015587826
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.007770253; Fold-change:0.293592783; Z-score:0.730056832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.314269503; Fold-change:0.324484114; Z-score:0.42932069
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.167811864; Fold-change:0.373491204; Z-score:2.259916288
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030261663; Fold-change:-0.448357774; Z-score:-0.969931741
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.715414342; Fold-change:0.318646174; Z-score:0.27210208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.144470562; Fold-change:0.442194062; Z-score:0.95848653
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.929145127; Fold-change:-0.259747006; Z-score:-0.543610537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036369543; Fold-change:0.557652552; Z-score:0.652987795
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.014702044; Fold-change:-0.187885051; Z-score:-0.346688458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.79154206; Fold-change:0.342220442; Z-score:0.406480276
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106486991; Fold-change:0.265855599; Z-score:0.901434942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.153207489; Fold-change:0.490462716; Z-score:0.760330712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.347126901; Fold-change:-0.257165635; Z-score:-0.367548017
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.717460394; Fold-change:0.039914914; Z-score:0.095817194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524276365; Fold-change:0.016695197; Z-score:0.015587826
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.007770253; Fold-change:0.293592783; Z-score:0.730056832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.314269503; Fold-change:0.324484114; Z-score:0.42932069
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.167811864; Fold-change:0.373491204; Z-score:2.259916288
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030261663; Fold-change:-0.448357774; Z-score:-0.969931741
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.715414342; Fold-change:0.318646174; Z-score:0.27210208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.144470562; Fold-change:0.442194062; Z-score:0.95848653
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.929145127; Fold-change:-0.259747006; Z-score:-0.543610537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036369543; Fold-change:0.557652552; Z-score:0.652987795
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.014702044; Fold-change:-0.187885051; Z-score:-0.346688458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.79154206; Fold-change:0.342220442; Z-score:0.406480276
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106486991; Fold-change:0.265855599; Z-score:0.901434942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.153207489; Fold-change:0.490462716; Z-score:0.760330712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.347126901; Fold-change:-0.257165635; Z-score:-0.367548017
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.717460394; Fold-change:0.039914914; Z-score:0.095817194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524276365; Fold-change:0.016695197; Z-score:0.015587826
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.007770253; Fold-change:0.293592783; Z-score:0.730056832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.314269503; Fold-change:0.324484114; Z-score:0.42932069
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.167811864; Fold-change:0.373491204; Z-score:2.259916288
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030261663; Fold-change:-0.448357774; Z-score:-0.969931741
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.715414342; Fold-change:0.318646174; Z-score:0.27210208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.144470562; Fold-change:0.442194062; Z-score:0.95848653
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.929145127; Fold-change:-0.259747006; Z-score:-0.543610537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036369543; Fold-change:0.557652552; Z-score:0.652987795
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.014702044; Fold-change:-0.187885051; Z-score:-0.346688458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.79154206; Fold-change:0.342220442; Z-score:0.406480276
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106486991; Fold-change:0.265855599; Z-score:0.901434942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.153207489; Fold-change:0.490462716; Z-score:0.760330712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.347126901; Fold-change:-0.257165635; Z-score:-0.367548017
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.717460394; Fold-change:0.039914914; Z-score:0.095817194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524276365; Fold-change:0.016695197; Z-score:0.015587826
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.007770253; Fold-change:0.293592783; Z-score:0.730056832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.314269503; Fold-change:0.324484114; Z-score:0.42932069
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.167811864; Fold-change:0.373491204; Z-score:2.259916288
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030261663; Fold-change:-0.448357774; Z-score:-0.969931741
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.715414342; Fold-change:0.318646174; Z-score:0.27210208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.144470562; Fold-change:0.442194062; Z-score:0.95848653
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.929145127; Fold-change:-0.259747006; Z-score:-0.543610537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036369543; Fold-change:0.557652552; Z-score:0.652987795
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.014702044; Fold-change:-0.187885051; Z-score:-0.346688458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.79154206; Fold-change:0.342220442; Z-score:0.406480276
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106486991; Fold-change:0.265855599; Z-score:0.901434942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.153207489; Fold-change:0.490462716; Z-score:0.760330712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.347126901; Fold-change:-0.257165635; Z-score:-0.367548017
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.717460394; Fold-change:0.039914914; Z-score:0.095817194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524276365; Fold-change:0.016695197; Z-score:0.015587826
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.007770253; Fold-change:0.293592783; Z-score:0.730056832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.314269503; Fold-change:0.324484114; Z-score:0.42932069
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.167811864; Fold-change:0.373491204; Z-score:2.259916288
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030261663; Fold-change:-0.448357774; Z-score:-0.969931741
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.715414342; Fold-change:0.318646174; Z-score:0.27210208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.144470562; Fold-change:0.442194062; Z-score:0.95848653
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.929145127; Fold-change:-0.259747006; Z-score:-0.543610537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036369543; Fold-change:0.557652552; Z-score:0.652987795
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.014702044; Fold-change:-0.187885051; Z-score:-0.346688458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.79154206; Fold-change:0.342220442; Z-score:0.406480276
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106486991; Fold-change:0.265855599; Z-score:0.901434942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.153207489; Fold-change:0.490462716; Z-score:0.760330712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.347126901; Fold-change:-0.257165635; Z-score:-0.367548017
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.717460394; Fold-change:0.039914914; Z-score:0.095817194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524276365; Fold-change:0.016695197; Z-score:0.015587826
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.007770253; Fold-change:0.293592783; Z-score:0.730056832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.314269503; Fold-change:0.324484114; Z-score:0.42932069
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.167811864; Fold-change:0.373491204; Z-score:2.259916288
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030261663; Fold-change:-0.448357774; Z-score:-0.969931741
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.715414342; Fold-change:0.318646174; Z-score:0.27210208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.144470562; Fold-change:0.442194062; Z-score:0.95848653
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.929145127; Fold-change:-0.259747006; Z-score:-0.543610537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036369543; Fold-change:0.557652552; Z-score:0.652987795
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.014702044; Fold-change:-0.187885051; Z-score:-0.346688458
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.79154206; Fold-change:0.342220442; Z-score:0.406480276
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106486991; Fold-change:0.265855599; Z-score:0.901434942
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.153207489; Fold-change:0.490462716; Z-score:0.760330712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.347126901; Fold-change:-0.257165635; Z-score:-0.367548017
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.717460394; Fold-change:0.039914914; Z-score:0.095817194
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524276365; Fold-change:0.016695197; Z-score:0.015587826
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.007770253; Fold-change:0.293592783; Z-score:0.730056832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.314269503; Fold-change:0.324484114; Z-score:0.42932069
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.167811864; Fold-change:0.373491204; Z-score:2.259916288
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030261663; Fold-change:-0.448357774; Z-score:-0.969931741
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.715414342; Fold-change:0.318646174; Z-score:0.27210208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.144470562; Fold-change:0.442194062; Z-score:0.95848653
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 09 Disease of the visual system
             [+] ICD-11: 9A96 Anterior uveitis Click to Show/Hide the Full List
The Studied Tissue Peripheral monocyte
The Specified Disease Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.173921493; Fold-change:-0.709056581; Z-score:-1.687092737
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.17E-08; Fold-change:0.873761194; Z-score:1.597735815
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.462179301; Fold-change:0.483988468; Z-score:0.601392474
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.790218969; Fold-change:-0.009690314; Z-score:-0.027915541
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.17E-08; Fold-change:0.873761194; Z-score:1.597735815
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.462179301; Fold-change:0.483988468; Z-score:0.601392474
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.790218969; Fold-change:-0.009690314; Z-score:-0.027915541
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.17E-08; Fold-change:0.873761194; Z-score:1.597735815
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.462179301; Fold-change:0.483988468; Z-score:0.601392474
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.790218969; Fold-change:-0.009690314; Z-score:-0.027915541
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.046808792; Fold-change:-0.703941136; Z-score:-0.801339514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001480511; Fold-change:-0.474703568; Z-score:-2.388355448
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.073128872; Fold-change:-0.981907195; Z-score:-0.954556792
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001032568; Fold-change:-0.317687008; Z-score:-0.527156951
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.914917947; Fold-change:-0.092534296; Z-score:-0.155839646
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.024189936; Fold-change:-0.129590447; Z-score:-0.200766315
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006424229; Fold-change:-0.848414484; Z-score:-1.59374596
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.046808792; Fold-change:-0.703941136; Z-score:-0.801339514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001480511; Fold-change:-0.474703568; Z-score:-2.388355448
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.073128872; Fold-change:-0.981907195; Z-score:-0.954556792
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001032568; Fold-change:-0.317687008; Z-score:-0.527156951
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.914917947; Fold-change:-0.092534296; Z-score:-0.155839646
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.024189936; Fold-change:-0.129590447; Z-score:-0.200766315
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006424229; Fold-change:-0.848414484; Z-score:-1.59374596
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.046808792; Fold-change:-0.703941136; Z-score:-0.801339514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001480511; Fold-change:-0.474703568; Z-score:-2.388355448
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.073128872; Fold-change:-0.981907195; Z-score:-0.954556792
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001032568; Fold-change:-0.317687008; Z-score:-0.527156951
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.914917947; Fold-change:-0.092534296; Z-score:-0.155839646
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.024189936; Fold-change:-0.129590447; Z-score:-0.200766315
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006424229; Fold-change:-0.848414484; Z-score:-1.59374596
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.046808792; Fold-change:-0.703941136; Z-score:-0.801339514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001480511; Fold-change:-0.474703568; Z-score:-2.388355448
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.073128872; Fold-change:-0.981907195; Z-score:-0.954556792
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001032568; Fold-change:-0.317687008; Z-score:-0.527156951
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.914917947; Fold-change:-0.092534296; Z-score:-0.155839646
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.024189936; Fold-change:-0.129590447; Z-score:-0.200766315
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006424229; Fold-change:-0.848414484; Z-score:-1.59374596
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.046808792; Fold-change:-0.703941136; Z-score:-0.801339514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001480511; Fold-change:-0.474703568; Z-score:-2.388355448
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.073128872; Fold-change:-0.981907195; Z-score:-0.954556792
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001032568; Fold-change:-0.317687008; Z-score:-0.527156951
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.914917947; Fold-change:-0.092534296; Z-score:-0.155839646
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.024189936; Fold-change:-0.129590447; Z-score:-0.200766315
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006424229; Fold-change:-0.848414484; Z-score:-1.59374596
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.046808792; Fold-change:-0.703941136; Z-score:-0.801339514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001480511; Fold-change:-0.474703568; Z-score:-2.388355448
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.073128872; Fold-change:-0.981907195; Z-score:-0.954556792
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001032568; Fold-change:-0.317687008; Z-score:-0.527156951
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.914917947; Fold-change:-0.092534296; Z-score:-0.155839646
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.024189936; Fold-change:-0.129590447; Z-score:-0.200766315
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006424229; Fold-change:-0.848414484; Z-score:-1.59374596
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.985867258; Fold-change:-0.000278848; Z-score:-0.000610835
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.096979437; Fold-change:0.238629556; Z-score:1.106820572
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.213252493; Fold-change:0.503534598; Z-score:1.268786537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001037651; Fold-change:-1.295284987; Z-score:-2.863059668
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000197034; Fold-change:0.558096707; Z-score:1.247210076
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.808304597; Fold-change:-0.075390041; Z-score:-0.1637969
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.985867258; Fold-change:-0.000278848; Z-score:-0.000610835
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.096979437; Fold-change:0.238629556; Z-score:1.106820572
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.213252493; Fold-change:0.503534598; Z-score:1.268786537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001037651; Fold-change:-1.295284987; Z-score:-2.863059668
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000197034; Fold-change:0.558096707; Z-score:1.247210076
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.808304597; Fold-change:-0.075390041; Z-score:-0.1637969
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.985867258; Fold-change:-0.000278848; Z-score:-0.000610835
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.096979437; Fold-change:0.238629556; Z-score:1.106820572
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.213252493; Fold-change:0.503534598; Z-score:1.268786537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001037651; Fold-change:-1.295284987; Z-score:-2.863059668
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000197034; Fold-change:0.558096707; Z-score:1.247210076
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.808304597; Fold-change:-0.075390041; Z-score:-0.1637969
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.985867258; Fold-change:-0.000278848; Z-score:-0.000610835
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.096979437; Fold-change:0.238629556; Z-score:1.106820572
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.213252493; Fold-change:0.503534598; Z-score:1.268786537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001037651; Fold-change:-1.295284987; Z-score:-2.863059668
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000197034; Fold-change:0.558096707; Z-score:1.247210076
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.808304597; Fold-change:-0.075390041; Z-score:-0.1637969
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.985867258; Fold-change:-0.000278848; Z-score:-0.000610835
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.096979437; Fold-change:0.238629556; Z-score:1.106820572
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.213252493; Fold-change:0.503534598; Z-score:1.268786537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001037651; Fold-change:-1.295284987; Z-score:-2.863059668
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000197034; Fold-change:0.558096707; Z-score:1.247210076
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.808304597; Fold-change:-0.075390041; Z-score:-0.1637969
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.985867258; Fold-change:-0.000278848; Z-score:-0.000610835
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.096979437; Fold-change:0.238629556; Z-score:1.106820572
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.213252493; Fold-change:0.503534598; Z-score:1.268786537
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001037651; Fold-change:-1.295284987; Z-score:-2.863059668
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000197034; Fold-change:0.558096707; Z-score:1.247210076
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.808304597; Fold-change:-0.075390041; Z-score:-0.1637969
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.60559385; Fold-change:-0.079745999; Z-score:-0.237495151
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.011174125; Fold-change:0.0746544; Z-score:0.098674546
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.82E-14; Fold-change:0.815346915; Z-score:1.200357323
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.452064889; Fold-change:0.030393706; Z-score:0.124600324
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.720960469; Fold-change:0.012583341; Z-score:0.01825799
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150781529; Fold-change:0.188476767; Z-score:0.764946156
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.60559385; Fold-change:-0.079745999; Z-score:-0.237495151
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.011174125; Fold-change:0.0746544; Z-score:0.098674546
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.82E-14; Fold-change:0.815346915; Z-score:1.200357323
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.452064889; Fold-change:0.030393706; Z-score:0.124600324
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.720960469; Fold-change:0.012583341; Z-score:0.01825799
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150781529; Fold-change:0.188476767; Z-score:0.764946156
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.60559385; Fold-change:-0.079745999; Z-score:-0.237495151
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.011174125; Fold-change:0.0746544; Z-score:0.098674546
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.82E-14; Fold-change:0.815346915; Z-score:1.200357323
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.452064889; Fold-change:0.030393706; Z-score:0.124600324
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.720960469; Fold-change:0.012583341; Z-score:0.01825799
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150781529; Fold-change:0.188476767; Z-score:0.764946156
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.60559385; Fold-change:-0.079745999; Z-score:-0.237495151
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.011174125; Fold-change:0.0746544; Z-score:0.098674546
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.82E-14; Fold-change:0.815346915; Z-score:1.200357323
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.452064889; Fold-change:0.030393706; Z-score:0.124600324
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.720960469; Fold-change:0.012583341; Z-score:0.01825799
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150781529; Fold-change:0.188476767; Z-score:0.764946156
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.60559385; Fold-change:-0.079745999; Z-score:-0.237495151
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.011174125; Fold-change:0.0746544; Z-score:0.098674546
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.82E-14; Fold-change:0.815346915; Z-score:1.200357323
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.452064889; Fold-change:0.030393706; Z-score:0.124600324
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.720960469; Fold-change:0.012583341; Z-score:0.01825799
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150781529; Fold-change:0.188476767; Z-score:0.764946156
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.239210313; Fold-change:0.109700412; Z-score:0.274000208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.551449676; Fold-change:0.212678678; Z-score:0.379594223
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000907633; Fold-change:1.010428638; Z-score:2.500750369
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.40E-15; Fold-change:0.968710138; Z-score:1.413932624
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.588487189; Fold-change:0.092357819; Z-score:0.206092248
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.07890313; Fold-change:-0.437732064; Z-score:-0.370632702
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.239210313; Fold-change:0.109700412; Z-score:0.274000208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.551449676; Fold-change:0.212678678; Z-score:0.379594223
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000907633; Fold-change:1.010428638; Z-score:2.500750369
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.40E-15; Fold-change:0.968710138; Z-score:1.413932624
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.588487189; Fold-change:0.092357819; Z-score:0.206092248
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.07890313; Fold-change:-0.437732064; Z-score:-0.370632702
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.239210313; Fold-change:0.109700412; Z-score:0.274000208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.551449676; Fold-change:0.212678678; Z-score:0.379594223
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000907633; Fold-change:1.010428638; Z-score:2.500750369
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.40E-15; Fold-change:0.968710138; Z-score:1.413932624
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.588487189; Fold-change:0.092357819; Z-score:0.206092248
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.07890313; Fold-change:-0.437732064; Z-score:-0.370632702
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.239210313; Fold-change:0.109700412; Z-score:0.274000208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.551449676; Fold-change:0.212678678; Z-score:0.379594223
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000907633; Fold-change:1.010428638; Z-score:2.500750369
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.40E-15; Fold-change:0.968710138; Z-score:1.413932624
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.588487189; Fold-change:0.092357819; Z-score:0.206092248
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.07890313; Fold-change:-0.437732064; Z-score:-0.370632702
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.239210313; Fold-change:0.109700412; Z-score:0.274000208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.551449676; Fold-change:0.212678678; Z-score:0.379594223
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000907633; Fold-change:1.010428638; Z-score:2.500750369
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.40E-15; Fold-change:0.968710138; Z-score:1.413932624
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.588487189; Fold-change:0.092357819; Z-score:0.206092248
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.07890313; Fold-change:-0.437732064; Z-score:-0.370632702
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.239210313; Fold-change:0.109700412; Z-score:0.274000208
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.551449676; Fold-change:0.212678678; Z-score:0.379594223
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000907633; Fold-change:1.010428638; Z-score:2.500750369
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.40E-15; Fold-change:0.968710138; Z-score:1.413932624
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.588487189; Fold-change:0.092357819; Z-score:0.206092248
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.07890313; Fold-change:-0.437732064; Z-score:-0.370632702
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 16 Disease of the genitourinary system
             [+] ICD-11: GA10 Endometriosis Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27364535; Fold-change:0.462357552; Z-score:0.69279783
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: GC00 Cystitis Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.087802042; Fold-change:-0.244285982; Z-score:-1.509532039
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 16 Disease of the genitourinary system
             [+] ICD-11: GA10 Endometriosis Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27364535; Fold-change:0.462357552; Z-score:0.69279783
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: GC00 Cystitis Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.087802042; Fold-change:-0.244285982; Z-score:-1.509532039
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 19 Certain condition originating in the perinatal period
             [+] ICD-11: KA21 Short gestation disorder Click to Show/Hide the Full List
The Studied Tissue Myometrium
The Specified Disease Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.824784909; Fold-change:-0.495264503; Z-score:-0.667398257
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 20 Developmental anomaly
             [+] ICD-11: LD2C Overgrowth syndrome Click to Show/Hide the Full List
The Studied Tissue Adipose tissue
The Specified Disease Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.064635538; Fold-change:0.284758121; Z-score:1.650871917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Perituberal tissue
The Specified Disease Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004343371; Fold-change:-1.440657733; Z-score:-2.734050989
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 20 Developmental anomaly
             [+] ICD-11: LD2C Overgrowth syndrome Click to Show/Hide the Full List
The Studied Tissue Adipose tissue
The Specified Disease Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.064635538; Fold-change:0.284758121; Z-score:1.650871917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Perituberal tissue
The Specified Disease Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004343371; Fold-change:-1.440657733; Z-score:-2.734050989
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
References
1 The Encyclopedia of DNA elements (ENCODE): data portal update. Nucleic Acids Res. 2018 Jan 4;46(D1):D794-D801
2 NCBI GEO: archive for functional genomics data sets--update. Nucleic Acids Res. 2013 Jan;41(D1):D991-5.
3 hTFtarget: A Comprehensive Database for Regulations of Human Transcription Factors and Their Targets. Genomics Proteomics Bioinformatics. 2020 Apr;18(2):120-469.
4 Closure of the NCBI SRA and implications for the long-term future of genomics data storage. Genome Biol. 2011;12(3):402.

If you find any error in data or bug in web service, please kindly report it to Dr. Li and Dr. Fu.