General Information of This TF
TF ID
TFD0135
TF name
Peroxisome proliferator-activated receptor gamma (PPARG)
Synonyms
NR1C3; Nuclear receptor subfamily 1 group C member 3; PPAR-gamma; PPARG
Gene Name
PPARG
Gene ID
5468
TF Classification Superclass Zinc-coordinating DNA-binding domains
Class Nuclear receptors with C4 zinc fingers
Family Thyroid hormone receptor-related factors (NR1)
Subfamily PPAR (NR1C)
Function This transcription factor is a nuclear receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids and modulates the transcription of its target genes, such as acyl-CoA oxidase.
Sequence
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
Uniprot ID
PPARG_HUMAN
Ensembl ID
ENSG00000132170
HGNC ID
HGNC:9236
JASPAR ID
MA0066.1
TF Binding Frequency Matrix TFD0135
Drug Transporter(s) Regulated by This TF

Activation

ABCA1

Transporter Info

Leukemia [ICD11: 2A20-2B3Z]

[1]

ABCA1

Transporter Info

Coronary artery disease [BA8Y]

[2]

ABCA1

Transporter Info

Acute monocytic leukemia [ICD11: 2A60.34]

[3]

ABCA1

Transporter Info

Type 2 diabetes [ICD11: 5A11]

[4]

ABCA12

Transporter Info

Harlequin ichthyosis [ICD11: EC20.02]

[5]

ABCG1

Transporter Info

Atherosclerosis [ICD11: BD40]

[6]

ABCG1

Transporter Info

Heallth [ICD11: N.A]

[7]

BCRP

Transporter Info

Heallth [ICD11: N.A]

[8]

BCRP

Transporter Info

Colon cancer [ICD11: 2B90]

[9]

FATP1

Transporter Info

Obesity [ICD11: 5B81]

[10]

GLUT1

Transporter Info

Heallth [ICD11: N.A]

[11]

GLUT4

Transporter Info

Polycystic ovary syndrome [ICD11: 5A80.1]

[12]

LAT1

Transporter Info

Heallth [ICD11: N.A]

[13]

LAT2

Transporter Info

Heallth [ICD11: N.A]

[13]

NIS

Transporter Info

Thyroid gland follicular carcinoma [2D10.0]

[14]

OATP2A1

Transporter Info

Heallth [ICD11: N.A]

[15]

OCT-1

Transporter Info

Hepatocellular carcinoma [ICD11: 2C12.02]

[16]

OCT-1

Transporter Info

Heallth [ICD11: N.A]

[17]

SLC25A7

Transporter Info

Type 2 diabetes [ICD11: 5A11]

[18]

SLC25A8

Transporter Info

Type 2 diabetes [ICD11: 5A11]

[18]

SLC25A9

Transporter Info

Type 2 diabetes [ICD11: 5A11]

[18]

SLC27A4

Transporter Info

Pregnancy [ICD11: JA00-JA2Z]

[19]

SLC27A4

Transporter Info

Colon cancer [ICD11: 2B90]

[20]

SLC9A3

Transporter Info

Type 2 diabetes [ICD11: 5A11]

[21]

TAUT

Transporter Info

Heallth [ICD11: N.A]

[13]

Repression

P-GP

Transporter Info

Ovarian endometrioid adenocarcinoma [ICD11: 2C73.01]

[22]

SLC9A1

Transporter Info

Breast cancer [ICD11: 2C60-2C6Z]

[23]

SNAT1

Transporter Info

Heallth [ICD11: N.A]

[24]

Direct binding

ABCA7

Transporter Info

ChIP sequencing in embryo

[25]

ABCB6

Transporter Info

ChIP sequencing in embryo

[26]

ABCD1

Transporter Info

ChIP sequencing in embryo

[27]

CACNA1C

Transporter Info

ChIP sequencing in embryo

[25]

GC1

Transporter Info

ChIP sequencing in embryo

[27]

KCNK4

Transporter Info

ChIP sequencing in embryo

[26]

MCT6

Transporter Info

ChIP sequencing in embryo

[28]

MDU1

Transporter Info

ChIP sequencing in embryo

[28]

SCAMC2

Transporter Info

ChIP sequencing in embryo

[28]

SCN8A

Transporter Info

ChIP sequencing in embryo

[28]

SLC25A1

Transporter Info

ChIP sequencing in embryo

[26]

SLC45A3

Transporter Info

ChIP sequencing in blood

[25]

SLC8A1

Transporter Info

ChIP sequencing in embryo

[26]

SLC9A8

Transporter Info

ChIP sequencing in embryo

[27]

THTR1

Transporter Info

ChIP sequencing in embryo

[25]

ZIP1

Transporter Info

ChIP sequencing in embryo

[25]

ZIP14

Transporter Info

ChIP sequencing in embryo

[26]

ZIP7

Transporter Info

ChIP sequencing in embryo

[27]
Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.029548494; Fold-change:0.115988869; Z-score:0.403021705
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579161254; Fold-change:0.33176824; Z-score:0.99389938
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.092607677; Fold-change:0.064943706; Z-score:0.361100998
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.22E-48; Fold-change:0.496725667; Z-score:1.560548586
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000299317; Fold-change:0.295474216; Z-score:1.768845616
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.322368317; Fold-change:0.070239915; Z-score:0.19682786
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.46E-17; Fold-change:0.554462467; Z-score:1.914491781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.029548494; Fold-change:0.115988869; Z-score:0.403021705
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579161254; Fold-change:0.33176824; Z-score:0.99389938
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.092607677; Fold-change:0.064943706; Z-score:0.361100998
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.22E-48; Fold-change:0.496725667; Z-score:1.560548586
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000299317; Fold-change:0.295474216; Z-score:1.768845616
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.322368317; Fold-change:0.070239915; Z-score:0.19682786
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.46E-17; Fold-change:0.554462467; Z-score:1.914491781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.029548494; Fold-change:0.115988869; Z-score:0.403021705
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579161254; Fold-change:0.33176824; Z-score:0.99389938
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.092607677; Fold-change:0.064943706; Z-score:0.361100998
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.22E-48; Fold-change:0.496725667; Z-score:1.560548586
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000299317; Fold-change:0.295474216; Z-score:1.768845616
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.322368317; Fold-change:0.070239915; Z-score:0.19682786
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.46E-17; Fold-change:0.554462467; Z-score:1.914491781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.029548494; Fold-change:0.115988869; Z-score:0.403021705
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579161254; Fold-change:0.33176824; Z-score:0.99389938
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.092607677; Fold-change:0.064943706; Z-score:0.361100998
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.22E-48; Fold-change:0.496725667; Z-score:1.560548586
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000299317; Fold-change:0.295474216; Z-score:1.768845616
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.322368317; Fold-change:0.070239915; Z-score:0.19682786
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.46E-17; Fold-change:0.554462467; Z-score:1.914491781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.029548494; Fold-change:0.115988869; Z-score:0.403021705
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579161254; Fold-change:0.33176824; Z-score:0.99389938
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.092607677; Fold-change:0.064943706; Z-score:0.361100998
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.22E-48; Fold-change:0.496725667; Z-score:1.560548586
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000299317; Fold-change:0.295474216; Z-score:1.768845616
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.322368317; Fold-change:0.070239915; Z-score:0.19682786
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.46E-17; Fold-change:0.554462467; Z-score:1.914491781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.029548494; Fold-change:0.115988869; Z-score:0.403021705
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579161254; Fold-change:0.33176824; Z-score:0.99389938
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.092607677; Fold-change:0.064943706; Z-score:0.361100998
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.22E-48; Fold-change:0.496725667; Z-score:1.560548586
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000299317; Fold-change:0.295474216; Z-score:1.768845616
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.322368317; Fold-change:0.070239915; Z-score:0.19682786
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.46E-17; Fold-change:0.554462467; Z-score:1.914491781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.029548494; Fold-change:0.115988869; Z-score:0.403021705
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579161254; Fold-change:0.33176824; Z-score:0.99389938
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.092607677; Fold-change:0.064943706; Z-score:0.361100998
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.22E-48; Fold-change:0.496725667; Z-score:1.560548586
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000299317; Fold-change:0.295474216; Z-score:1.768845616
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.322368317; Fold-change:0.070239915; Z-score:0.19682786
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.46E-17; Fold-change:0.554462467; Z-score:1.914491781
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234797736; Fold-change:-0.241433153; Z-score:-0.689561212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.727079112; Fold-change:-0.09268892; Z-score:-0.098917478
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.805527982; Fold-change:-0.056862445; Z-score:-0.039727431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.728693786; Fold-change:-0.030447277; Z-score:-0.092725926
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.438580401; Fold-change:0.044665697; Z-score:0.282355016
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002806483; Fold-change:0.117308189; Z-score:0.636863383
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000693595; Fold-change:0.425266398; Z-score:0.56338703
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000650459; Fold-change:0.468031508; Z-score:1.949975239
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.106403901; Fold-change:-0.180906731; Z-score:-0.567777333
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.45597242; Fold-change:-0.018095823; Z-score:-0.117071123
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04995401; Fold-change:-0.331960461; Z-score:-1.169458771
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.50E-05; Fold-change:0.060144655; Z-score:0.136991394
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000708898; Fold-change:-0.721128937; Z-score:-1.24876403
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.016266391; Fold-change:-0.249026636; Z-score:-0.361385794
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.303605297; Fold-change:-0.488930754; Z-score:-0.818978681
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.924102208; Fold-change:-0.457626906; Z-score:-0.257302216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-07; Fold-change:-0.45955431; Z-score:-1.046803591
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.22E-58; Fold-change:-1.167184351; Z-score:-2.024699342
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.93E-15; Fold-change:-0.762899949; Z-score:-0.911787231
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000160844; Fold-change:-0.897381222; Z-score:-3.320228412
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.012896168; Fold-change:-0.647097129; Z-score:-1.462810482
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003104445; Fold-change:1.600414133; Z-score:1.256643573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.48E-10; Fold-change:1.337507956; Z-score:1.435831413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003017423; Fold-change:0.194496938; Z-score:0.322140269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.83E-18; Fold-change:0.453473372; Z-score:0.976355207
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.169703985; Fold-change:0.142209138; Z-score:0.771907319
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.56E-83; Fold-change:-1.790940542; Z-score:-2.420253485
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.86E-62; Fold-change:-1.603362713; Z-score:-2.634400546
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.84E-05; Fold-change:-2.314373473; Z-score:-1.460895692
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.41E-65; Fold-change:-1.569417231; Z-score:-1.824005013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.34E-54; Fold-change:-1.437291761; Z-score:-1.655307246
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.64E-71; Fold-change:-2.801172364; Z-score:-1.659050154
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.34E-12; Fold-change:-2.038718171; Z-score:-1.344772327
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.025760329; Fold-change:-0.94527927; Z-score:-0.882008577
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.416511605; Fold-change:-0.262467216; Z-score:-0.240367665
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.680427694; Fold-change:-0.146365817; Z-score:-0.317674322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.97E-05; Fold-change:-0.390941076; Z-score:-0.577818201
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.88904113; Fold-change:0.580705389; Z-score:0.593975712
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018206188; Fold-change:-0.485503043; Z-score:-0.79455161
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.500693357; Fold-change:0.177389857; Z-score:0.578524441
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.194730812; Fold-change:0.262717203; Z-score:0.643235419
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.273023527; Fold-change:0.10571426; Z-score:0.337681295
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001844873; Fold-change:-1.114833626; Z-score:-1.756522186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003179138; Fold-change:0.579976032; Z-score:2.482292284
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.86E-27; Fold-change:-1.006611048; Z-score:-2.019945191
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.90E-14; Fold-change:-1.058721465; Z-score:-1.95034457
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.088982661; Fold-change:-0.114877564; Z-score:-0.252490634
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.66E-05; Fold-change:0.490359555; Z-score:2.512503027
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050871642; Fold-change:0.218692893; Z-score:1.198171949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.05E-10; Fold-change:-0.661272418; Z-score:-0.999593748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.029103272; Fold-change:0.149438759; Z-score:0.780028784
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.383808655; Fold-change:0.199631378; Z-score:0.706320193
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.097350445; Fold-change:0.11192878; Z-score:0.602589344
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.421090514; Fold-change:2.915131981; Z-score:1.643578374
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.029103272; Fold-change:0.149438759; Z-score:0.780028784
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.383808655; Fold-change:0.199631378; Z-score:0.706320193
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.097350445; Fold-change:0.11192878; Z-score:0.602589344
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.421090514; Fold-change:2.915131981; Z-score:1.643578374
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.029103272; Fold-change:0.149438759; Z-score:0.780028784
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.383808655; Fold-change:0.199631378; Z-score:0.706320193
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.097350445; Fold-change:0.11192878; Z-score:0.602589344
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.421090514; Fold-change:2.915131981; Z-score:1.643578374
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.029103272; Fold-change:0.149438759; Z-score:0.780028784
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.383808655; Fold-change:0.199631378; Z-score:0.706320193
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.097350445; Fold-change:0.11192878; Z-score:0.602589344
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.421090514; Fold-change:2.915131981; Z-score:1.643578374
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.020728798; Fold-change:0.17236398; Z-score:1.592988115
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.696151183; Fold-change:-0.031461385; Z-score:-0.083851318
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037216994; Fold-change:0.130844026; Z-score:0.530085368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.145252527; Fold-change:0.497554744; Z-score:1.828942083
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.268641137; Fold-change:-0.39842973; Z-score:-0.830832006
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.402875758; Fold-change:0.167731992; Z-score:0.884539158
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.782186282; Fold-change:-0.020768473; Z-score:-0.117822382
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.020728798; Fold-change:0.17236398; Z-score:1.592988115
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.696151183; Fold-change:-0.031461385; Z-score:-0.083851318
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037216994; Fold-change:0.130844026; Z-score:0.530085368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.145252527; Fold-change:0.497554744; Z-score:1.828942083
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.268641137; Fold-change:-0.39842973; Z-score:-0.830832006
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.402875758; Fold-change:0.167731992; Z-score:0.884539158
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.782186282; Fold-change:-0.020768473; Z-score:-0.117822382
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.020728798; Fold-change:0.17236398; Z-score:1.592988115
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.696151183; Fold-change:-0.031461385; Z-score:-0.083851318
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037216994; Fold-change:0.130844026; Z-score:0.530085368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.145252527; Fold-change:0.497554744; Z-score:1.828942083
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.268641137; Fold-change:-0.39842973; Z-score:-0.830832006
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.402875758; Fold-change:0.167731992; Z-score:0.884539158
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.782186282; Fold-change:-0.020768473; Z-score:-0.117822382
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.020728798; Fold-change:0.17236398; Z-score:1.592988115
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.696151183; Fold-change:-0.031461385; Z-score:-0.083851318
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037216994; Fold-change:0.130844026; Z-score:0.530085368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.145252527; Fold-change:0.497554744; Z-score:1.828942083
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.268641137; Fold-change:-0.39842973; Z-score:-0.830832006
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.402875758; Fold-change:0.167731992; Z-score:0.884539158
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.782186282; Fold-change:-0.020768473; Z-score:-0.117822382
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.020728798; Fold-change:0.17236398; Z-score:1.592988115
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.696151183; Fold-change:-0.031461385; Z-score:-0.083851318
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037216994; Fold-change:0.130844026; Z-score:0.530085368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.145252527; Fold-change:0.497554744; Z-score:1.828942083
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.268641137; Fold-change:-0.39842973; Z-score:-0.830832006
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.402875758; Fold-change:0.167731992; Z-score:0.884539158
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.782186282; Fold-change:-0.020768473; Z-score:-0.117822382
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.020728798; Fold-change:0.17236398; Z-score:1.592988115
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.696151183; Fold-change:-0.031461385; Z-score:-0.083851318
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037216994; Fold-change:0.130844026; Z-score:0.530085368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.145252527; Fold-change:0.497554744; Z-score:1.828942083
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.268641137; Fold-change:-0.39842973; Z-score:-0.830832006
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.402875758; Fold-change:0.167731992; Z-score:0.884539158
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.782186282; Fold-change:-0.020768473; Z-score:-0.117822382
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.085192902; Fold-change:0.255226792; Z-score:1.074887459
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018819701; Fold-change:-0.214887897; Z-score:-0.785928228
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.916806361; Fold-change:0.037686209; Z-score:0.093186278
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.536242648; Fold-change:0.024537851; Z-score:0.166394932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00107193; Fold-change:0.785081562; Z-score:2.140277654
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.957183574; Fold-change:-0.024522444; Z-score:-0.267215711
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579993404; Fold-change:0.007340117; Z-score:0.043011075
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.551421575; Fold-change:-0.031476414; Z-score:-0.127017792
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.085192902; Fold-change:0.255226792; Z-score:1.074887459
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018819701; Fold-change:-0.214887897; Z-score:-0.785928228
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.916806361; Fold-change:0.037686209; Z-score:0.093186278
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.536242648; Fold-change:0.024537851; Z-score:0.166394932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00107193; Fold-change:0.785081562; Z-score:2.140277654
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.957183574; Fold-change:-0.024522444; Z-score:-0.267215711
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579993404; Fold-change:0.007340117; Z-score:0.043011075
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.551421575; Fold-change:-0.031476414; Z-score:-0.127017792
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.085192902; Fold-change:0.255226792; Z-score:1.074887459
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018819701; Fold-change:-0.214887897; Z-score:-0.785928228
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.916806361; Fold-change:0.037686209; Z-score:0.093186278
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.536242648; Fold-change:0.024537851; Z-score:0.166394932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00107193; Fold-change:0.785081562; Z-score:2.140277654
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.957183574; Fold-change:-0.024522444; Z-score:-0.267215711
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579993404; Fold-change:0.007340117; Z-score:0.043011075
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.551421575; Fold-change:-0.031476414; Z-score:-0.127017792
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.085192902; Fold-change:0.255226792; Z-score:1.074887459
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018819701; Fold-change:-0.214887897; Z-score:-0.785928228
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.916806361; Fold-change:0.037686209; Z-score:0.093186278
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.536242648; Fold-change:0.024537851; Z-score:0.166394932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00107193; Fold-change:0.785081562; Z-score:2.140277654
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.957183574; Fold-change:-0.024522444; Z-score:-0.267215711
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579993404; Fold-change:0.007340117; Z-score:0.043011075
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.551421575; Fold-change:-0.031476414; Z-score:-0.127017792
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.085192902; Fold-change:0.255226792; Z-score:1.074887459
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018819701; Fold-change:-0.214887897; Z-score:-0.785928228
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.916806361; Fold-change:0.037686209; Z-score:0.093186278
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.536242648; Fold-change:0.024537851; Z-score:0.166394932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00107193; Fold-change:0.785081562; Z-score:2.140277654
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.957183574; Fold-change:-0.024522444; Z-score:-0.267215711
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579993404; Fold-change:0.007340117; Z-score:0.043011075
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.551421575; Fold-change:-0.031476414; Z-score:-0.127017792
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.085192902; Fold-change:0.255226792; Z-score:1.074887459
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018819701; Fold-change:-0.214887897; Z-score:-0.785928228
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.916806361; Fold-change:0.037686209; Z-score:0.093186278
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.536242648; Fold-change:0.024537851; Z-score:0.166394932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00107193; Fold-change:0.785081562; Z-score:2.140277654
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.957183574; Fold-change:-0.024522444; Z-score:-0.267215711
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579993404; Fold-change:0.007340117; Z-score:0.043011075
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.551421575; Fold-change:-0.031476414; Z-score:-0.127017792
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.085192902; Fold-change:0.255226792; Z-score:1.074887459
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.018819701; Fold-change:-0.214887897; Z-score:-0.785928228
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.916806361; Fold-change:0.037686209; Z-score:0.093186278
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.536242648; Fold-change:0.024537851; Z-score:0.166394932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00107193; Fold-change:0.785081562; Z-score:2.140277654
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.957183574; Fold-change:-0.024522444; Z-score:-0.267215711
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579993404; Fold-change:0.007340117; Z-score:0.043011075
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.551421575; Fold-change:-0.031476414; Z-score:-0.127017792
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.824965126; Fold-change:-0.001889991; Z-score:-0.007576547
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.61738947; Fold-change:-0.010520858; Z-score:-0.042607931
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697338873; Fold-change:0.019778748; Z-score:0.141252517
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.073338611; Fold-change:0.062015091; Z-score:0.21905396
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.23106267; Fold-change:0.042195771; Z-score:0.19176979
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.266918872; Fold-change:0.048128545; Z-score:0.187578001
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.824965126; Fold-change:-0.001889991; Z-score:-0.007576547
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.61738947; Fold-change:-0.010520858; Z-score:-0.042607931
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697338873; Fold-change:0.019778748; Z-score:0.141252517
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.073338611; Fold-change:0.062015091; Z-score:0.21905396
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.23106267; Fold-change:0.042195771; Z-score:0.19176979
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.266918872; Fold-change:0.048128545; Z-score:0.187578001
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.824965126; Fold-change:-0.001889991; Z-score:-0.007576547
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.61738947; Fold-change:-0.010520858; Z-score:-0.042607931
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697338873; Fold-change:0.019778748; Z-score:0.141252517
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.073338611; Fold-change:0.062015091; Z-score:0.21905396
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.23106267; Fold-change:0.042195771; Z-score:0.19176979
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.266918872; Fold-change:0.048128545; Z-score:0.187578001
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.824965126; Fold-change:-0.001889991; Z-score:-0.007576547
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.61738947; Fold-change:-0.010520858; Z-score:-0.042607931
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697338873; Fold-change:0.019778748; Z-score:0.141252517
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.073338611; Fold-change:0.062015091; Z-score:0.21905396
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.23106267; Fold-change:0.042195771; Z-score:0.19176979
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.266918872; Fold-change:0.048128545; Z-score:0.187578001
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.824965126; Fold-change:-0.001889991; Z-score:-0.007576547
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.61738947; Fold-change:-0.010520858; Z-score:-0.042607931
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697338873; Fold-change:0.019778748; Z-score:0.141252517
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.073338611; Fold-change:0.062015091; Z-score:0.21905396
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.23106267; Fold-change:0.042195771; Z-score:0.19176979
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.266918872; Fold-change:0.048128545; Z-score:0.187578001
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.687746308; Fold-change:0.013520686; Z-score:0.038499917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009656877; Fold-change:0.115976153; Z-score:0.932496864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.241193362; Fold-change:-0.063409613; Z-score:-0.247006532
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.457865951; Fold-change:-0.097432273; Z-score:-0.444116997
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.695675869; Fold-change:0.204719018; Z-score:0.681981779
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.274675192; Fold-change:0.091261818; Z-score:0.581091958
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.498407542; Fold-change:0.287159558; Z-score:0.691795006
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.178802664; Fold-change:-0.090760402; Z-score:-0.345408477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.10122118; Fold-change:-0.534977653; Z-score:-0.995135126
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.10E-07; Fold-change:0.337695934; Z-score:1.574722242
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22137215; Fold-change:0.072968596; Z-score:0.241549418
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.91635431; Fold-change:-0.151347911; Z-score:-0.285262051
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164612044; Fold-change:-0.068694037; Z-score:-0.383869638
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015280872; Fold-change:0.223606159; Z-score:0.91475477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008182115; Fold-change:0.395622376; Z-score:1.112223002
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.687746308; Fold-change:0.013520686; Z-score:0.038499917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009656877; Fold-change:0.115976153; Z-score:0.932496864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.241193362; Fold-change:-0.063409613; Z-score:-0.247006532
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.457865951; Fold-change:-0.097432273; Z-score:-0.444116997
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.695675869; Fold-change:0.204719018; Z-score:0.681981779
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.274675192; Fold-change:0.091261818; Z-score:0.581091958
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.498407542; Fold-change:0.287159558; Z-score:0.691795006
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.178802664; Fold-change:-0.090760402; Z-score:-0.345408477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.10122118; Fold-change:-0.534977653; Z-score:-0.995135126
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.10E-07; Fold-change:0.337695934; Z-score:1.574722242
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22137215; Fold-change:0.072968596; Z-score:0.241549418
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.91635431; Fold-change:-0.151347911; Z-score:-0.285262051
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164612044; Fold-change:-0.068694037; Z-score:-0.383869638
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015280872; Fold-change:0.223606159; Z-score:0.91475477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008182115; Fold-change:0.395622376; Z-score:1.112223002
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.687746308; Fold-change:0.013520686; Z-score:0.038499917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009656877; Fold-change:0.115976153; Z-score:0.932496864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.241193362; Fold-change:-0.063409613; Z-score:-0.247006532
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.457865951; Fold-change:-0.097432273; Z-score:-0.444116997
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.695675869; Fold-change:0.204719018; Z-score:0.681981779
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.274675192; Fold-change:0.091261818; Z-score:0.581091958
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.498407542; Fold-change:0.287159558; Z-score:0.691795006
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.178802664; Fold-change:-0.090760402; Z-score:-0.345408477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.10122118; Fold-change:-0.534977653; Z-score:-0.995135126
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.10E-07; Fold-change:0.337695934; Z-score:1.574722242
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22137215; Fold-change:0.072968596; Z-score:0.241549418
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.91635431; Fold-change:-0.151347911; Z-score:-0.285262051
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164612044; Fold-change:-0.068694037; Z-score:-0.383869638
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015280872; Fold-change:0.223606159; Z-score:0.91475477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008182115; Fold-change:0.395622376; Z-score:1.112223002
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.687746308; Fold-change:0.013520686; Z-score:0.038499917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009656877; Fold-change:0.115976153; Z-score:0.932496864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.241193362; Fold-change:-0.063409613; Z-score:-0.247006532
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.457865951; Fold-change:-0.097432273; Z-score:-0.444116997
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.695675869; Fold-change:0.204719018; Z-score:0.681981779
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.274675192; Fold-change:0.091261818; Z-score:0.581091958
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.498407542; Fold-change:0.287159558; Z-score:0.691795006
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.178802664; Fold-change:-0.090760402; Z-score:-0.345408477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.10122118; Fold-change:-0.534977653; Z-score:-0.995135126
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.10E-07; Fold-change:0.337695934; Z-score:1.574722242
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22137215; Fold-change:0.072968596; Z-score:0.241549418
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.91635431; Fold-change:-0.151347911; Z-score:-0.285262051
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164612044; Fold-change:-0.068694037; Z-score:-0.383869638
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015280872; Fold-change:0.223606159; Z-score:0.91475477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008182115; Fold-change:0.395622376; Z-score:1.112223002
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.687746308; Fold-change:0.013520686; Z-score:0.038499917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009656877; Fold-change:0.115976153; Z-score:0.932496864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.241193362; Fold-change:-0.063409613; Z-score:-0.247006532
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.457865951; Fold-change:-0.097432273; Z-score:-0.444116997
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.695675869; Fold-change:0.204719018; Z-score:0.681981779
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.274675192; Fold-change:0.091261818; Z-score:0.581091958
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.498407542; Fold-change:0.287159558; Z-score:0.691795006
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.178802664; Fold-change:-0.090760402; Z-score:-0.345408477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.10122118; Fold-change:-0.534977653; Z-score:-0.995135126
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.10E-07; Fold-change:0.337695934; Z-score:1.574722242
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22137215; Fold-change:0.072968596; Z-score:0.241549418
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.91635431; Fold-change:-0.151347911; Z-score:-0.285262051
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164612044; Fold-change:-0.068694037; Z-score:-0.383869638
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015280872; Fold-change:0.223606159; Z-score:0.91475477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008182115; Fold-change:0.395622376; Z-score:1.112223002
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.687746308; Fold-change:0.013520686; Z-score:0.038499917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009656877; Fold-change:0.115976153; Z-score:0.932496864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.241193362; Fold-change:-0.063409613; Z-score:-0.247006532
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.457865951; Fold-change:-0.097432273; Z-score:-0.444116997
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.695675869; Fold-change:0.204719018; Z-score:0.681981779
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.274675192; Fold-change:0.091261818; Z-score:0.581091958
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.498407542; Fold-change:0.287159558; Z-score:0.691795006
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.178802664; Fold-change:-0.090760402; Z-score:-0.345408477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.10122118; Fold-change:-0.534977653; Z-score:-0.995135126
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.10E-07; Fold-change:0.337695934; Z-score:1.574722242
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22137215; Fold-change:0.072968596; Z-score:0.241549418
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.91635431; Fold-change:-0.151347911; Z-score:-0.285262051
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164612044; Fold-change:-0.068694037; Z-score:-0.383869638
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015280872; Fold-change:0.223606159; Z-score:0.91475477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008182115; Fold-change:0.395622376; Z-score:1.112223002
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.687746308; Fold-change:0.013520686; Z-score:0.038499917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009656877; Fold-change:0.115976153; Z-score:0.932496864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.241193362; Fold-change:-0.063409613; Z-score:-0.247006532
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.457865951; Fold-change:-0.097432273; Z-score:-0.444116997
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.695675869; Fold-change:0.204719018; Z-score:0.681981779
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.274675192; Fold-change:0.091261818; Z-score:0.581091958
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.498407542; Fold-change:0.287159558; Z-score:0.691795006
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.178802664; Fold-change:-0.090760402; Z-score:-0.345408477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.10122118; Fold-change:-0.534977653; Z-score:-0.995135126
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.10E-07; Fold-change:0.337695934; Z-score:1.574722242
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22137215; Fold-change:0.072968596; Z-score:0.241549418
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.91635431; Fold-change:-0.151347911; Z-score:-0.285262051
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164612044; Fold-change:-0.068694037; Z-score:-0.383869638
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015280872; Fold-change:0.223606159; Z-score:0.91475477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008182115; Fold-change:0.395622376; Z-score:1.112223002
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.687746308; Fold-change:0.013520686; Z-score:0.038499917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009656877; Fold-change:0.115976153; Z-score:0.932496864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.241193362; Fold-change:-0.063409613; Z-score:-0.247006532
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.457865951; Fold-change:-0.097432273; Z-score:-0.444116997
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.695675869; Fold-change:0.204719018; Z-score:0.681981779
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.274675192; Fold-change:0.091261818; Z-score:0.581091958
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.498407542; Fold-change:0.287159558; Z-score:0.691795006
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.178802664; Fold-change:-0.090760402; Z-score:-0.345408477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.10122118; Fold-change:-0.534977653; Z-score:-0.995135126
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.10E-07; Fold-change:0.337695934; Z-score:1.574722242
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22137215; Fold-change:0.072968596; Z-score:0.241549418
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.91635431; Fold-change:-0.151347911; Z-score:-0.285262051
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164612044; Fold-change:-0.068694037; Z-score:-0.383869638
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015280872; Fold-change:0.223606159; Z-score:0.91475477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008182115; Fold-change:0.395622376; Z-score:1.112223002
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.687746308; Fold-change:0.013520686; Z-score:0.038499917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009656877; Fold-change:0.115976153; Z-score:0.932496864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.241193362; Fold-change:-0.063409613; Z-score:-0.247006532
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.457865951; Fold-change:-0.097432273; Z-score:-0.444116997
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.695675869; Fold-change:0.204719018; Z-score:0.681981779
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.274675192; Fold-change:0.091261818; Z-score:0.581091958
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.498407542; Fold-change:0.287159558; Z-score:0.691795006
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.178802664; Fold-change:-0.090760402; Z-score:-0.345408477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.10122118; Fold-change:-0.534977653; Z-score:-0.995135126
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.10E-07; Fold-change:0.337695934; Z-score:1.574722242
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22137215; Fold-change:0.072968596; Z-score:0.241549418
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.91635431; Fold-change:-0.151347911; Z-score:-0.285262051
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164612044; Fold-change:-0.068694037; Z-score:-0.383869638
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015280872; Fold-change:0.223606159; Z-score:0.91475477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008182115; Fold-change:0.395622376; Z-score:1.112223002
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.687746308; Fold-change:0.013520686; Z-score:0.038499917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009656877; Fold-change:0.115976153; Z-score:0.932496864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.241193362; Fold-change:-0.063409613; Z-score:-0.247006532
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.457865951; Fold-change:-0.097432273; Z-score:-0.444116997
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.695675869; Fold-change:0.204719018; Z-score:0.681981779
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.274675192; Fold-change:0.091261818; Z-score:0.581091958
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.498407542; Fold-change:0.287159558; Z-score:0.691795006
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.178802664; Fold-change:-0.090760402; Z-score:-0.345408477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.10122118; Fold-change:-0.534977653; Z-score:-0.995135126
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.10E-07; Fold-change:0.337695934; Z-score:1.574722242
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22137215; Fold-change:0.072968596; Z-score:0.241549418
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.91635431; Fold-change:-0.151347911; Z-score:-0.285262051
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164612044; Fold-change:-0.068694037; Z-score:-0.383869638
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015280872; Fold-change:0.223606159; Z-score:0.91475477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008182115; Fold-change:0.395622376; Z-score:1.112223002
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.687746308; Fold-change:0.013520686; Z-score:0.038499917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009656877; Fold-change:0.115976153; Z-score:0.932496864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.241193362; Fold-change:-0.063409613; Z-score:-0.247006532
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.457865951; Fold-change:-0.097432273; Z-score:-0.444116997
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.695675869; Fold-change:0.204719018; Z-score:0.681981779
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.274675192; Fold-change:0.091261818; Z-score:0.581091958
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.498407542; Fold-change:0.287159558; Z-score:0.691795006
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.178802664; Fold-change:-0.090760402; Z-score:-0.345408477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.10122118; Fold-change:-0.534977653; Z-score:-0.995135126
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.10E-07; Fold-change:0.337695934; Z-score:1.574722242
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22137215; Fold-change:0.072968596; Z-score:0.241549418
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.91635431; Fold-change:-0.151347911; Z-score:-0.285262051
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164612044; Fold-change:-0.068694037; Z-score:-0.383869638
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015280872; Fold-change:0.223606159; Z-score:0.91475477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008182115; Fold-change:0.395622376; Z-score:1.112223002
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.687746308; Fold-change:0.013520686; Z-score:0.038499917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009656877; Fold-change:0.115976153; Z-score:0.932496864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.241193362; Fold-change:-0.063409613; Z-score:-0.247006532
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.457865951; Fold-change:-0.097432273; Z-score:-0.444116997
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.695675869; Fold-change:0.204719018; Z-score:0.681981779
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.274675192; Fold-change:0.091261818; Z-score:0.581091958
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.498407542; Fold-change:0.287159558; Z-score:0.691795006
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.178802664; Fold-change:-0.090760402; Z-score:-0.345408477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.10122118; Fold-change:-0.534977653; Z-score:-0.995135126
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.10E-07; Fold-change:0.337695934; Z-score:1.574722242
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22137215; Fold-change:0.072968596; Z-score:0.241549418
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.91635431; Fold-change:-0.151347911; Z-score:-0.285262051
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164612044; Fold-change:-0.068694037; Z-score:-0.383869638
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015280872; Fold-change:0.223606159; Z-score:0.91475477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008182115; Fold-change:0.395622376; Z-score:1.112223002
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.687746308; Fold-change:0.013520686; Z-score:0.038499917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009656877; Fold-change:0.115976153; Z-score:0.932496864
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.241193362; Fold-change:-0.063409613; Z-score:-0.247006532
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.457865951; Fold-change:-0.097432273; Z-score:-0.444116997
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.695675869; Fold-change:0.204719018; Z-score:0.681981779
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.274675192; Fold-change:0.091261818; Z-score:0.581091958
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.498407542; Fold-change:0.287159558; Z-score:0.691795006
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.178802664; Fold-change:-0.090760402; Z-score:-0.345408477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.10122118; Fold-change:-0.534977653; Z-score:-0.995135126
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.10E-07; Fold-change:0.337695934; Z-score:1.574722242
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22137215; Fold-change:0.072968596; Z-score:0.241549418
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.91635431; Fold-change:-0.151347911; Z-score:-0.285262051
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164612044; Fold-change:-0.068694037; Z-score:-0.383869638
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015280872; Fold-change:0.223606159; Z-score:0.91475477
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008182115; Fold-change:0.395622376; Z-score:1.112223002
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 09 Disease of the visual system
             [+] ICD-11: 9A96 Anterior uveitis Click to Show/Hide the Full List
The Studied Tissue Peripheral monocyte
The Specified Disease Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.632416439; Fold-change:-0.124362994; Z-score:-0.660078455
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.245646116; Fold-change:0.1295528; Z-score:0.289610332
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030879265; Fold-change:0.080534178; Z-score:1.124751268
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435873671; Fold-change:0.086163553; Z-score:0.082587946
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.245646116; Fold-change:0.1295528; Z-score:0.289610332
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030879265; Fold-change:0.080534178; Z-score:1.124751268
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435873671; Fold-change:0.086163553; Z-score:0.082587946
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.245646116; Fold-change:0.1295528; Z-score:0.289610332
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.030879265; Fold-change:0.080534178; Z-score:1.124751268
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.435873671; Fold-change:0.086163553; Z-score:0.082587946
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.787850741; Fold-change:0.237254441; Z-score:0.792673952
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.147157419; Fold-change:0.294268848; Z-score:0.657266065
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.549445241; Fold-change:0.185564707; Z-score:0.67808258
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.038469165; Fold-change:0.231769839; Z-score:0.324159169
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.482484038; Fold-change:0.126909165; Z-score:0.24277265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008333393; Fold-change:0.41919102; Z-score:0.556357549
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.570606707; Fold-change:0.184661438; Z-score:0.586032902
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.787850741; Fold-change:0.237254441; Z-score:0.792673952
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.147157419; Fold-change:0.294268848; Z-score:0.657266065
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.549445241; Fold-change:0.185564707; Z-score:0.67808258
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.038469165; Fold-change:0.231769839; Z-score:0.324159169
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.482484038; Fold-change:0.126909165; Z-score:0.24277265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008333393; Fold-change:0.41919102; Z-score:0.556357549
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.570606707; Fold-change:0.184661438; Z-score:0.586032902
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.787850741; Fold-change:0.237254441; Z-score:0.792673952
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.147157419; Fold-change:0.294268848; Z-score:0.657266065
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.549445241; Fold-change:0.185564707; Z-score:0.67808258
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.038469165; Fold-change:0.231769839; Z-score:0.324159169
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.482484038; Fold-change:0.126909165; Z-score:0.24277265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008333393; Fold-change:0.41919102; Z-score:0.556357549
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.570606707; Fold-change:0.184661438; Z-score:0.586032902
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.787850741; Fold-change:0.237254441; Z-score:0.792673952
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.147157419; Fold-change:0.294268848; Z-score:0.657266065
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.549445241; Fold-change:0.185564707; Z-score:0.67808258
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.038469165; Fold-change:0.231769839; Z-score:0.324159169
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.482484038; Fold-change:0.126909165; Z-score:0.24277265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008333393; Fold-change:0.41919102; Z-score:0.556357549
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.570606707; Fold-change:0.184661438; Z-score:0.586032902
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.787850741; Fold-change:0.237254441; Z-score:0.792673952
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.147157419; Fold-change:0.294268848; Z-score:0.657266065
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.549445241; Fold-change:0.185564707; Z-score:0.67808258
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.038469165; Fold-change:0.231769839; Z-score:0.324159169
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.482484038; Fold-change:0.126909165; Z-score:0.24277265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008333393; Fold-change:0.41919102; Z-score:0.556357549
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.570606707; Fold-change:0.184661438; Z-score:0.586032902
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.787850741; Fold-change:0.237254441; Z-score:0.792673952
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.147157419; Fold-change:0.294268848; Z-score:0.657266065
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.549445241; Fold-change:0.185564707; Z-score:0.67808258
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.038469165; Fold-change:0.231769839; Z-score:0.324159169
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.482484038; Fold-change:0.126909165; Z-score:0.24277265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.008333393; Fold-change:0.41919102; Z-score:0.556357549
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.570606707; Fold-change:0.184661438; Z-score:0.586032902
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.033460378; Fold-change:0.111415792; Z-score:0.40793449
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.30325053; Fold-change:-0.291110645; Z-score:-0.755857507
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.024437468; Fold-change:0.641862949; Z-score:1.333850354
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.395039105; Fold-change:-0.189985905; Z-score:-0.294052202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.056552764; Fold-change:-0.543281114; Z-score:-0.617426629
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035519911; Fold-change:-0.196640404; Z-score:-0.437037175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.033460378; Fold-change:0.111415792; Z-score:0.40793449
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.30325053; Fold-change:-0.291110645; Z-score:-0.755857507
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.024437468; Fold-change:0.641862949; Z-score:1.333850354
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.395039105; Fold-change:-0.189985905; Z-score:-0.294052202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.056552764; Fold-change:-0.543281114; Z-score:-0.617426629
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035519911; Fold-change:-0.196640404; Z-score:-0.437037175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.033460378; Fold-change:0.111415792; Z-score:0.40793449
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.30325053; Fold-change:-0.291110645; Z-score:-0.755857507
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.024437468; Fold-change:0.641862949; Z-score:1.333850354
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.395039105; Fold-change:-0.189985905; Z-score:-0.294052202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.056552764; Fold-change:-0.543281114; Z-score:-0.617426629
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035519911; Fold-change:-0.196640404; Z-score:-0.437037175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.033460378; Fold-change:0.111415792; Z-score:0.40793449
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.30325053; Fold-change:-0.291110645; Z-score:-0.755857507
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.024437468; Fold-change:0.641862949; Z-score:1.333850354
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.395039105; Fold-change:-0.189985905; Z-score:-0.294052202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.056552764; Fold-change:-0.543281114; Z-score:-0.617426629
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035519911; Fold-change:-0.196640404; Z-score:-0.437037175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.033460378; Fold-change:0.111415792; Z-score:0.40793449
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.30325053; Fold-change:-0.291110645; Z-score:-0.755857507
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.024437468; Fold-change:0.641862949; Z-score:1.333850354
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.395039105; Fold-change:-0.189985905; Z-score:-0.294052202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.056552764; Fold-change:-0.543281114; Z-score:-0.617426629
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035519911; Fold-change:-0.196640404; Z-score:-0.437037175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.033460378; Fold-change:0.111415792; Z-score:0.40793449
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.30325053; Fold-change:-0.291110645; Z-score:-0.755857507
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.024437468; Fold-change:0.641862949; Z-score:1.333850354
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.395039105; Fold-change:-0.189985905; Z-score:-0.294052202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.056552764; Fold-change:-0.543281114; Z-score:-0.617426629
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.035519911; Fold-change:-0.196640404; Z-score:-0.437037175
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.022269145; Fold-change:-1.027782364; Z-score:-1.070544122
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.87E-19; Fold-change:-0.790205853; Z-score:-1.166012077
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.18E-07; Fold-change:-0.479519403; Z-score:-0.637476757
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.312002595; Fold-change:-0.408686862; Z-score:-0.420421203
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001086026; Fold-change:0.466099264; Z-score:0.640147881
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.601247347; Fold-change:-0.08080908; Z-score:-0.299928756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.022269145; Fold-change:-1.027782364; Z-score:-1.070544122
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.87E-19; Fold-change:-0.790205853; Z-score:-1.166012077
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.18E-07; Fold-change:-0.479519403; Z-score:-0.637476757
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.312002595; Fold-change:-0.408686862; Z-score:-0.420421203
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001086026; Fold-change:0.466099264; Z-score:0.640147881
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.601247347; Fold-change:-0.08080908; Z-score:-0.299928756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.022269145; Fold-change:-1.027782364; Z-score:-1.070544122
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.87E-19; Fold-change:-0.790205853; Z-score:-1.166012077
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.18E-07; Fold-change:-0.479519403; Z-score:-0.637476757
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.312002595; Fold-change:-0.408686862; Z-score:-0.420421203
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001086026; Fold-change:0.466099264; Z-score:0.640147881
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.601247347; Fold-change:-0.08080908; Z-score:-0.299928756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.022269145; Fold-change:-1.027782364; Z-score:-1.070544122
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.87E-19; Fold-change:-0.790205853; Z-score:-1.166012077
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.18E-07; Fold-change:-0.479519403; Z-score:-0.637476757
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.312002595; Fold-change:-0.408686862; Z-score:-0.420421203
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001086026; Fold-change:0.466099264; Z-score:0.640147881
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.601247347; Fold-change:-0.08080908; Z-score:-0.299928756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.022269145; Fold-change:-1.027782364; Z-score:-1.070544122
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.87E-19; Fold-change:-0.790205853; Z-score:-1.166012077
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.18E-07; Fold-change:-0.479519403; Z-score:-0.637476757
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.312002595; Fold-change:-0.408686862; Z-score:-0.420421203
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001086026; Fold-change:0.466099264; Z-score:0.640147881
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.601247347; Fold-change:-0.08080908; Z-score:-0.299928756
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.316642817; Fold-change:0.037704708; Z-score:0.223839352
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.350474097; Fold-change:-0.912437727; Z-score:-0.712989498
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.062568633; Fold-change:-0.7735535; Z-score:-0.912386897
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.052292515; Fold-change:0.047348472; Z-score:0.144730786
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.319146991; Fold-change:0.12445135; Z-score:0.263716404
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.654773654; Fold-change:0.037533329; Z-score:0.061423057
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.316642817; Fold-change:0.037704708; Z-score:0.223839352
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.350474097; Fold-change:-0.912437727; Z-score:-0.712989498
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.062568633; Fold-change:-0.7735535; Z-score:-0.912386897
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.052292515; Fold-change:0.047348472; Z-score:0.144730786
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.319146991; Fold-change:0.12445135; Z-score:0.263716404
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.654773654; Fold-change:0.037533329; Z-score:0.061423057
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.316642817; Fold-change:0.037704708; Z-score:0.223839352
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.350474097; Fold-change:-0.912437727; Z-score:-0.712989498
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.062568633; Fold-change:-0.7735535; Z-score:-0.912386897
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.052292515; Fold-change:0.047348472; Z-score:0.144730786
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.319146991; Fold-change:0.12445135; Z-score:0.263716404
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.654773654; Fold-change:0.037533329; Z-score:0.061423057
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.316642817; Fold-change:0.037704708; Z-score:0.223839352
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.350474097; Fold-change:-0.912437727; Z-score:-0.712989498
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.062568633; Fold-change:-0.7735535; Z-score:-0.912386897
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.052292515; Fold-change:0.047348472; Z-score:0.144730786
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.319146991; Fold-change:0.12445135; Z-score:0.263716404
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.654773654; Fold-change:0.037533329; Z-score:0.061423057
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.316642817; Fold-change:0.037704708; Z-score:0.223839352
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.350474097; Fold-change:-0.912437727; Z-score:-0.712989498
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.062568633; Fold-change:-0.7735535; Z-score:-0.912386897
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.052292515; Fold-change:0.047348472; Z-score:0.144730786
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.319146991; Fold-change:0.12445135; Z-score:0.263716404
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.654773654; Fold-change:0.037533329; Z-score:0.061423057
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.316642817; Fold-change:0.037704708; Z-score:0.223839352
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.350474097; Fold-change:-0.912437727; Z-score:-0.712989498
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.062568633; Fold-change:-0.7735535; Z-score:-0.912386897
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.052292515; Fold-change:0.047348472; Z-score:0.144730786
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.319146991; Fold-change:0.12445135; Z-score:0.263716404
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.654773654; Fold-change:0.037533329; Z-score:0.061423057
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 16 Disease of the genitourinary system
             [+] ICD-11: GA10 Endometriosis Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.024181155; Fold-change:0.168943678; Z-score:0.194993585
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: GC00 Cystitis Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000110565; Fold-change:-2.575280951; Z-score:-10.74139178
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 16 Disease of the genitourinary system
             [+] ICD-11: GA10 Endometriosis Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.024181155; Fold-change:0.168943678; Z-score:0.194993585
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: GC00 Cystitis Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000110565; Fold-change:-2.575280951; Z-score:-10.74139178
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 19 Certain condition originating in the perinatal period
             [+] ICD-11: KA21 Short gestation disorder Click to Show/Hide the Full List
The Studied Tissue Myometrium
The Specified Disease Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.089172044; Fold-change:0.718845925; Z-score:2.822477237
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 20 Developmental anomaly
             [+] ICD-11: LD2C Overgrowth syndrome Click to Show/Hide the Full List
The Studied Tissue Adipose tissue
The Specified Disease Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.962317938; Fold-change:-0.000260488; Z-score:-0.000601867
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Perituberal tissue
The Specified Disease Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.824910363; Fold-change:-0.093319429; Z-score:-0.736416066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 20 Developmental anomaly
             [+] ICD-11: LD2C Overgrowth syndrome Click to Show/Hide the Full List
The Studied Tissue Adipose tissue
The Specified Disease Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.962317938; Fold-change:-0.000260488; Z-score:-0.000601867
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Perituberal tissue
The Specified Disease Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.824910363; Fold-change:-0.093319429; Z-score:-0.736416066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
References
1 The RXR agonists PA024 and HX630 have different abilities to activate LXR/RXR and to induce ABCA1 expression in macrophage cell lines. Biochem Pharmacol. 2008 Oct 15;76(8):1006-13.
2 Phospholipase A2 group IIA correlates with circulating high-density lipoprotein cholesterol and modulates cholesterol efflux possibly through regulation of PPAR-gamma/LXR-alpha/ABCA1 in macrophages. J Transl Med. 2021 Nov 27;19(1):484.
3 Quercetin increases macrophage cholesterol efflux to inhibit foam cell formation through activating PPARgamma-ABCA1 pathway. Int J Clin Exp Pathol. 2015 Sep 1;8(9):10854-60.
4 Patient Adipose Stem Cell-Derived Adipocytes Reveal Genetic Variation that Predicts Antidiabetic Drug Response. Cell Stem Cell. 2019 Feb 7;24(2):299-308.e6.
5 Keratinocyte differentiation and upregulation of ceramide synthesis induced by an oat lipid extract via the activation of PPAR pathways. Exp Dermatol. 2015 Apr;24(4):290-5.
6 Differential inhibition of macrophage foam-cell formation and atherosclerosis in mice by PPARalpha, beta/delta, and gamma. J Clin Invest. 2004 Dec;114(11):1564-76.
7 PPAR-gamma pathways attenuate pulmonary granuloma formation in a carbon nanotube induced murine model of sarcoidosis. Biochem Biophys Res Commun. 2018 Sep 5;503(2):684-690.
8 Peroxisome proliferator-activated receptor gamma-regulated ABCG2 expression confers cytoprotection to human dendritic cells. J Biol Chem. 2006 Aug 18;281(33):23812-23.
9 Short-chain fatty acids exert opposite effects on the expression and function of p-glycoprotein and breast cancer resistance protein in rat intestine. Acta Pharmacol Sin. 2021 Mar;42(3):470-481.
10 Expression of putative fatty acid transporter genes are regulated by peroxisome proliferator-activated receptor alpha and gamma activators in a tissue- and inducer-specific manner. J Biol Chem. 1998 Jul 3;273(27):16710-4.
11 Potentiation of glucose uptake in 3T3-L1 adipocytes by PPAR gamma agonists is maintained in cells expressing a PPAR gamma dominant-negative mutant: evidence for selectivity in the downstream responses to PPAR gamma activation. Mol Endocrinol. 2001 Oct;15(10):1729-38.
12 Role of the transcriptional factors FOXO1 and PPARG on gene expression of SLC2A4 in endometrial tissue from women with polycystic ovary syndrome. Reproduction. 2010 Jul;140(1):123-31.
13 PPARgama stimulates expression of L-type amino acid and taurine transporters in human placentas: the evidence of PPARgama regulating fetal growth. Sci Rep. 2015 Jul 31;5:12650.
14 Troglitazone, the peroxisome proliferator-activated receptor-gamma agonist, induces antiproliferation and redifferentiation in human thyroid cancer cell lines. Thyroid. 2005 Mar;15(3):222-31.
15 Peroxisome proliferator-activated receptor beta/delta and gamma agonists differentially affect prostaglandin E2 and cytokine synthesis and nutrient transporter expression in porcine trophoblast cells during implantation. Theriogenology. 2020 Aug;152:36-46.
16 Transcriptional regulation of murine Slc22a1 (Oct1) by peroxisome proliferator agonist receptor-alpha and -gamma. Am J Physiol Gastrointest Liver Physiol. 2005 Feb;288(2):G207-12.
17 Regulation of the growth arrest and DNA damage-inducible gene 45 (GADD45) by peroxisome proliferator-activated receptor gamma in vascular smooth muscle cells. Circ Res. 2003 Aug 22;93(4):e38-47.
18 Peroxisome proliferator-activated receptors gamma and alpha mediate in vivo regulation of uncoupling protein (UCP-1, UCP-2, UCP-3) gene expression. Endocrinology. 1998 Dec;139(12):4920-7.
19 Peroxisome proliferator-activated receptor-gamma and retinoid X receptor signaling regulate fatty acid uptake by primary human placental trophoblasts. J Clin Endocrinol Metab. 2005 Jul;90(7):4267-75.
20 Structure-dependent effects of pyridine derivatives on mechanisms of intestinal fatty acid uptake: regulation of nicotinic acid receptor and fatty acid transporter expression. J Nutr Biochem. 2014 Jul;25(7):750-7.
21 The role of Sgk-1 in the upregulation of transport proteins by PPAR-{gamma} agonists in human proximal tubule cells. Nephrol Dial Transplant. 2009 Apr;24(4):1130-41.
22 Suppression of multidrug resistance by rosiglitazone treatment in human ovarian cancer cells through downregulation of FZD1 and MDR1 genes. Anticancer Drugs. 2015 Aug;26(7):706-15.
23 Repression of NHE1 expression by PPARgamma activation is a potential new approach for specific inhibition of the growth of tumor cells in vitro and in vivo. Cancer Res. 2009 Nov 15;69(22):8636-44.
24 Regulation of expression and role of peroxisome proliferator-activated receptors (PPARs) in luminal epithelial and stromal cells of the porcine endometrium. Theriogenology. 2019 Mar 15;127:88-101.
25 hTFtarget: A Comprehensive Database for Regulations of Human Transcription Factors and Their Targets. Genomics Proteomics Bioinformatics. 2020 Apr;18(2):120-469.
26 NCBI GEO: archive for functional genomics data sets--update. Nucleic Acids Res. 2013 Jan;41(D1):D991-5.
27 Closure of the NCBI SRA and implications for the long-term future of genomics data storage. Genome Biol. 2011;12(3):402.
28 The Encyclopedia of DNA elements (ENCODE): data portal update. Nucleic Acids Res. 2018 Jan 4;46(D1):D794-D801

If you find any error in data or bug in web service, please kindly report it to Dr. Li and Dr. Fu.