General Information of This TF
TF ID
TFD0164
TF name
Signal transducer and activator of transcription 3 (STAT3)
Synonyms
APRF; Acute-phase response factor; STAT3
Gene Name
STAT3
Gene ID
6774
TF Classification Superclass Immunoglobulin fold
Class STAT domain factors
Family STAT factors
Subfamily Other factors
Function This transcription factor is a signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF, LEP and other growth factors.
Sequence
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Uniprot ID
STAT3_HUMAN
Ensembl ID
ENSG00000168610
HGNC ID
HGNC:11364
JASPAR ID
MA0144.2
TF Binding Frequency Matrix TFD0164
Drug Transporter(s) Regulated by This TF

Activation

ABCA3

Transporter Info

Heallth [ICD11: N.A]

[1]

ANXA2

Transporter Info

Non-alcoholic steatohepatitis [ICD11: DB92.1]

[2]

BCRP

Transporter Info

Epithelial ovarian cancer [2B5D.0]

[3]

GLUT2

Transporter Info

Obesity [ICD11: 5B81]

[4]

OCTN2

Transporter Info

Heallth [ICD11: N.A]

[5]

P-GP

Transporter Info

Lung adenocarcinoma [ICD11: 2C25.0]

[6]

P-GP

Transporter Info

Cervical epithelioid carcinoma [2C77.Z]

[7]

SLC9A3

Transporter Info

Heallth [ICD11: N.A]

[8]

VACHT

Transporter Info

Alzheimer disease [ICD11: 8A20]

[9]

ZIP2

Transporter Info

Myocardial ischemia [ICD11: BA6Z]

[10]

Direct binding

SLC41A2

Transporter Info

ChIP sequencing in blood

[11]
Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.259382781; Fold-change:0.105423343; Z-score:0.288493604
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.954431506; Fold-change:0.126448926; Z-score:3.018501345
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.058142012; Fold-change:0.124058078; Z-score:0.934889063
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.91E-27; Fold-change:0.864544048; Z-score:1.417467587
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.75E-06; Fold-change:0.336995825; Z-score:2.041946561
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.064638246; Fold-change:0.003370077; Z-score:0.025265911
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.42E-17; Fold-change:0.848018934; Z-score:1.530104949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.259382781; Fold-change:0.105423343; Z-score:0.288493604
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.954431506; Fold-change:0.126448926; Z-score:3.018501345
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.058142012; Fold-change:0.124058078; Z-score:0.934889063
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.91E-27; Fold-change:0.864544048; Z-score:1.417467587
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.75E-06; Fold-change:0.336995825; Z-score:2.041946561
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.064638246; Fold-change:0.003370077; Z-score:0.025265911
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.42E-17; Fold-change:0.848018934; Z-score:1.530104949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.259382781; Fold-change:0.105423343; Z-score:0.288493604
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.954431506; Fold-change:0.126448926; Z-score:3.018501345
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.058142012; Fold-change:0.124058078; Z-score:0.934889063
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.91E-27; Fold-change:0.864544048; Z-score:1.417467587
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.75E-06; Fold-change:0.336995825; Z-score:2.041946561
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.064638246; Fold-change:0.003370077; Z-score:0.025265911
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.42E-17; Fold-change:0.848018934; Z-score:1.530104949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.259382781; Fold-change:0.105423343; Z-score:0.288493604
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.954431506; Fold-change:0.126448926; Z-score:3.018501345
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.058142012; Fold-change:0.124058078; Z-score:0.934889063
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.91E-27; Fold-change:0.864544048; Z-score:1.417467587
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.75E-06; Fold-change:0.336995825; Z-score:2.041946561
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.064638246; Fold-change:0.003370077; Z-score:0.025265911
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.42E-17; Fold-change:0.848018934; Z-score:1.530104949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.259382781; Fold-change:0.105423343; Z-score:0.288493604
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.954431506; Fold-change:0.126448926; Z-score:3.018501345
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.058142012; Fold-change:0.124058078; Z-score:0.934889063
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.91E-27; Fold-change:0.864544048; Z-score:1.417467587
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.75E-06; Fold-change:0.336995825; Z-score:2.041946561
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.064638246; Fold-change:0.003370077; Z-score:0.025265911
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.42E-17; Fold-change:0.848018934; Z-score:1.530104949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.259382781; Fold-change:0.105423343; Z-score:0.288493604
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.954431506; Fold-change:0.126448926; Z-score:3.018501345
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.058142012; Fold-change:0.124058078; Z-score:0.934889063
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.91E-27; Fold-change:0.864544048; Z-score:1.417467587
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.75E-06; Fold-change:0.336995825; Z-score:2.041946561
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.064638246; Fold-change:0.003370077; Z-score:0.025265911
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.42E-17; Fold-change:0.848018934; Z-score:1.530104949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.259382781; Fold-change:0.105423343; Z-score:0.288493604
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.954431506; Fold-change:0.126448926; Z-score:3.018501345
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.058142012; Fold-change:0.124058078; Z-score:0.934889063
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.91E-27; Fold-change:0.864544048; Z-score:1.417467587
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.75E-06; Fold-change:0.336995825; Z-score:2.041946561
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.064638246; Fold-change:0.003370077; Z-score:0.025265911
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.42E-17; Fold-change:0.848018934; Z-score:1.530104949
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.72E-24; Fold-change:0.331970662; Z-score:0.539295433
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.27954341; Fold-change:0.25686094; Z-score:1.486794209
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000524187; Fold-change:1.380697417; Z-score:2.128591327
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000104284; Fold-change:-0.380210359; Z-score:-1.575990195
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001885779; Fold-change:-0.740545587; Z-score:-2.970005487
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013072759; Fold-change:-0.149990978; Z-score:-0.542127009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.60E-05; Fold-change:0.240550599; Z-score:0.763312936
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.325868229; Fold-change:-0.511138051; Z-score:-0.48175374
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.697958654; Fold-change:0.05949107; Z-score:0.180721202
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430838437; Fold-change:0.405373969; Z-score:0.847912932
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.612460201; Fold-change:0.140666791; Z-score:0.688587542
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000241757; Fold-change:-0.060618501; Z-score:-0.170100219
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.255762687; Fold-change:0.614085448; Z-score:0.885976326
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.021981697; Fold-change:0.351824037; Z-score:0.489636351
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00339757; Fold-change:-0.887368023; Z-score:-2.51864941
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.127236931; Fold-change:0.65344725; Z-score:1.614082425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.16E-10; Fold-change:0.682578749; Z-score:3.197063782
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.026348909; Fold-change:0.003672631; Z-score:0.011273719
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:7.41E-23; Fold-change:0.647683696; Z-score:1.317515213
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.153242372; Fold-change:0.158997901; Z-score:1.04219633
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.005846551; Fold-change:0.281181678; Z-score:1.965999403
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.938223779; Fold-change:0.015633184; Z-score:0.014538985
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.002244138; Fold-change:0.513395313; Z-score:1.061382808
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.006499477; Fold-change:-0.115612427; Z-score:-0.211247184
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.208679709; Fold-change:0.187387981; Z-score:0.301075411
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.086390308; Fold-change:-0.559707613; Z-score:-1.067840369
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000391839; Fold-change:-0.058542391; Z-score:-0.157778204
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.00029893; Fold-change:-0.242138197; Z-score:-0.408180413
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0176216; Fold-change:0.331722779; Z-score:0.341773591
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.95E-08; Fold-change:-0.260956803; Z-score:-0.536310421
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:8.14E-05; Fold-change:0.412702896; Z-score:0.733112029
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.117730588; Fold-change:0.130594628; Z-score:0.168971612
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.013124214; Fold-change:0.067526434; Z-score:0.103867169
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.867029449; Fold-change:0.381896649; Z-score:0.521402611
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000959425; Fold-change:0.959462751; Z-score:1.471344967
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004706801; Fold-change:0.172881859; Z-score:0.567127272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:7.29E-07; Fold-change:-0.325794736; Z-score:-0.506983052
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.54E-05; Fold-change:-0.637782898; Z-score:-3.381903741
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:6.41E-06; Fold-change:-0.79693109; Z-score:-1.462747225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.66610968; Fold-change:0.12583688; Z-score:0.243193019
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.07E-07; Fold-change:-0.117594569; Z-score:-0.361589625
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.110033109; Fold-change:-0.019974156; Z-score:-0.050079839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223772892; Fold-change:-0.045566176; Z-score:-0.164417601
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.85E-10; Fold-change:1.143419936; Z-score:4.055988044
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00379869; Fold-change:0.243541629; Z-score:0.697509892
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:4.03E-08; Fold-change:0.656831958; Z-score:1.237643602
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.016174048; Fold-change:-0.1297848; Z-score:-0.422916752
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.56E-06; Fold-change:-1.287631975; Z-score:-2.195232809
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:-2.035785137; Z-score:-3.455576186
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.59E-10; Fold-change:0.324258627; Z-score:0.872021472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.023743017; Fold-change:0.42842817; Z-score:1.054649805
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.874222673; Fold-change:0.012989906; Z-score:0.054931687
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.01508306; Fold-change:-0.253979649; Z-score:-0.98847225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.850034574; Fold-change:-0.080383422; Z-score:-0.124998128
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.023743017; Fold-change:0.42842817; Z-score:1.054649805
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.874222673; Fold-change:0.012989906; Z-score:0.054931687
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.01508306; Fold-change:-0.253979649; Z-score:-0.98847225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.850034574; Fold-change:-0.080383422; Z-score:-0.124998128
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.023743017; Fold-change:0.42842817; Z-score:1.054649805
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.874222673; Fold-change:0.012989906; Z-score:0.054931687
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.01508306; Fold-change:-0.253979649; Z-score:-0.98847225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.850034574; Fold-change:-0.080383422; Z-score:-0.124998128
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.023743017; Fold-change:0.42842817; Z-score:1.054649805
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.874222673; Fold-change:0.012989906; Z-score:0.054931687
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.01508306; Fold-change:-0.253979649; Z-score:-0.98847225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.850034574; Fold-change:-0.080383422; Z-score:-0.124998128
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.093683755; Fold-change:0.02716396; Z-score:0.276624359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.603764319; Fold-change:-0.294940953; Z-score:-0.310962934
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0274188; Fold-change:0.082153884; Z-score:0.41724001
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.502814276; Fold-change:-0.192405531; Z-score:-1.175943073
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.006408078; Fold-change:0.39569075; Z-score:2.182000399
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858238962; Fold-change:0.040907076; Z-score:0.131987185
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.042563623; Fold-change:-0.50675565; Z-score:-1.61543911
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.093683755; Fold-change:0.02716396; Z-score:0.276624359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.603764319; Fold-change:-0.294940953; Z-score:-0.310962934
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0274188; Fold-change:0.082153884; Z-score:0.41724001
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.502814276; Fold-change:-0.192405531; Z-score:-1.175943073
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.006408078; Fold-change:0.39569075; Z-score:2.182000399
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858238962; Fold-change:0.040907076; Z-score:0.131987185
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.042563623; Fold-change:-0.50675565; Z-score:-1.61543911
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.093683755; Fold-change:0.02716396; Z-score:0.276624359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.603764319; Fold-change:-0.294940953; Z-score:-0.310962934
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0274188; Fold-change:0.082153884; Z-score:0.41724001
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.502814276; Fold-change:-0.192405531; Z-score:-1.175943073
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.006408078; Fold-change:0.39569075; Z-score:2.182000399
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858238962; Fold-change:0.040907076; Z-score:0.131987185
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.042563623; Fold-change:-0.50675565; Z-score:-1.61543911
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.093683755; Fold-change:0.02716396; Z-score:0.276624359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.603764319; Fold-change:-0.294940953; Z-score:-0.310962934
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0274188; Fold-change:0.082153884; Z-score:0.41724001
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.502814276; Fold-change:-0.192405531; Z-score:-1.175943073
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.006408078; Fold-change:0.39569075; Z-score:2.182000399
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858238962; Fold-change:0.040907076; Z-score:0.131987185
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.042563623; Fold-change:-0.50675565; Z-score:-1.61543911
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.093683755; Fold-change:0.02716396; Z-score:0.276624359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.603764319; Fold-change:-0.294940953; Z-score:-0.310962934
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0274188; Fold-change:0.082153884; Z-score:0.41724001
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.502814276; Fold-change:-0.192405531; Z-score:-1.175943073
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.006408078; Fold-change:0.39569075; Z-score:2.182000399
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858238962; Fold-change:0.040907076; Z-score:0.131987185
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.042563623; Fold-change:-0.50675565; Z-score:-1.61543911
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.093683755; Fold-change:0.02716396; Z-score:0.276624359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.603764319; Fold-change:-0.294940953; Z-score:-0.310962934
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0274188; Fold-change:0.082153884; Z-score:0.41724001
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.502814276; Fold-change:-0.192405531; Z-score:-1.175943073
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.006408078; Fold-change:0.39569075; Z-score:2.182000399
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858238962; Fold-change:0.040907076; Z-score:0.131987185
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.042563623; Fold-change:-0.50675565; Z-score:-1.61543911
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.334691221; Fold-change:-0.056873301; Z-score:-0.15794886
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013376837; Fold-change:0.140055207; Z-score:0.613721287
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.864795346; Fold-change:0.09497463; Z-score:0.339563407
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150646606; Fold-change:0.102212359; Z-score:0.374616839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000287272; Fold-change:0.509725215; Z-score:1.853262994
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374674463; Fold-change:-0.060972394; Z-score:-0.445012272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22285604; Fold-change:-0.120538243; Z-score:-0.586790374
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.464236336; Fold-change:-0.090949607; Z-score:-0.348881104
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.334691221; Fold-change:-0.056873301; Z-score:-0.15794886
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013376837; Fold-change:0.140055207; Z-score:0.613721287
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.864795346; Fold-change:0.09497463; Z-score:0.339563407
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150646606; Fold-change:0.102212359; Z-score:0.374616839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000287272; Fold-change:0.509725215; Z-score:1.853262994
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374674463; Fold-change:-0.060972394; Z-score:-0.445012272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22285604; Fold-change:-0.120538243; Z-score:-0.586790374
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.464236336; Fold-change:-0.090949607; Z-score:-0.348881104
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.334691221; Fold-change:-0.056873301; Z-score:-0.15794886
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013376837; Fold-change:0.140055207; Z-score:0.613721287
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.864795346; Fold-change:0.09497463; Z-score:0.339563407
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150646606; Fold-change:0.102212359; Z-score:0.374616839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000287272; Fold-change:0.509725215; Z-score:1.853262994
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374674463; Fold-change:-0.060972394; Z-score:-0.445012272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22285604; Fold-change:-0.120538243; Z-score:-0.586790374
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.464236336; Fold-change:-0.090949607; Z-score:-0.348881104
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.334691221; Fold-change:-0.056873301; Z-score:-0.15794886
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013376837; Fold-change:0.140055207; Z-score:0.613721287
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.864795346; Fold-change:0.09497463; Z-score:0.339563407
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150646606; Fold-change:0.102212359; Z-score:0.374616839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000287272; Fold-change:0.509725215; Z-score:1.853262994
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374674463; Fold-change:-0.060972394; Z-score:-0.445012272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22285604; Fold-change:-0.120538243; Z-score:-0.586790374
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.464236336; Fold-change:-0.090949607; Z-score:-0.348881104
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.334691221; Fold-change:-0.056873301; Z-score:-0.15794886
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013376837; Fold-change:0.140055207; Z-score:0.613721287
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.864795346; Fold-change:0.09497463; Z-score:0.339563407
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150646606; Fold-change:0.102212359; Z-score:0.374616839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000287272; Fold-change:0.509725215; Z-score:1.853262994
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374674463; Fold-change:-0.060972394; Z-score:-0.445012272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22285604; Fold-change:-0.120538243; Z-score:-0.586790374
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.464236336; Fold-change:-0.090949607; Z-score:-0.348881104
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.334691221; Fold-change:-0.056873301; Z-score:-0.15794886
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013376837; Fold-change:0.140055207; Z-score:0.613721287
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.864795346; Fold-change:0.09497463; Z-score:0.339563407
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150646606; Fold-change:0.102212359; Z-score:0.374616839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000287272; Fold-change:0.509725215; Z-score:1.853262994
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374674463; Fold-change:-0.060972394; Z-score:-0.445012272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22285604; Fold-change:-0.120538243; Z-score:-0.586790374
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.464236336; Fold-change:-0.090949607; Z-score:-0.348881104
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.334691221; Fold-change:-0.056873301; Z-score:-0.15794886
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013376837; Fold-change:0.140055207; Z-score:0.613721287
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.864795346; Fold-change:0.09497463; Z-score:0.339563407
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150646606; Fold-change:0.102212359; Z-score:0.374616839
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000287272; Fold-change:0.509725215; Z-score:1.853262994
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374674463; Fold-change:-0.060972394; Z-score:-0.445012272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.22285604; Fold-change:-0.120538243; Z-score:-0.586790374
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.464236336; Fold-change:-0.090949607; Z-score:-0.348881104
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.641927344; Fold-change:0.022860168; Z-score:0.046277463
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.012032844; Fold-change:0.27502777; Z-score:0.41179235
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.107634205; Fold-change:0.140853991; Z-score:0.668294311
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.095411197; Fold-change:0.103979033; Z-score:0.706898857
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.502598064; Fold-change:0.071435969; Z-score:0.218929212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.663392425; Fold-change:0.001984393; Z-score:0.013006139
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.641927344; Fold-change:0.022860168; Z-score:0.046277463
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.012032844; Fold-change:0.27502777; Z-score:0.41179235
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.107634205; Fold-change:0.140853991; Z-score:0.668294311
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.095411197; Fold-change:0.103979033; Z-score:0.706898857
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.502598064; Fold-change:0.071435969; Z-score:0.218929212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.663392425; Fold-change:0.001984393; Z-score:0.013006139
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.641927344; Fold-change:0.022860168; Z-score:0.046277463
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.012032844; Fold-change:0.27502777; Z-score:0.41179235
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.107634205; Fold-change:0.140853991; Z-score:0.668294311
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.095411197; Fold-change:0.103979033; Z-score:0.706898857
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.502598064; Fold-change:0.071435969; Z-score:0.218929212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.663392425; Fold-change:0.001984393; Z-score:0.013006139
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.641927344; Fold-change:0.022860168; Z-score:0.046277463
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.012032844; Fold-change:0.27502777; Z-score:0.41179235
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.107634205; Fold-change:0.140853991; Z-score:0.668294311
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.095411197; Fold-change:0.103979033; Z-score:0.706898857
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.502598064; Fold-change:0.071435969; Z-score:0.218929212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.663392425; Fold-change:0.001984393; Z-score:0.013006139
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.641927344; Fold-change:0.022860168; Z-score:0.046277463
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.012032844; Fold-change:0.27502777; Z-score:0.41179235
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.107634205; Fold-change:0.140853991; Z-score:0.668294311
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.095411197; Fold-change:0.103979033; Z-score:0.706898857
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.502598064; Fold-change:0.071435969; Z-score:0.218929212
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.663392425; Fold-change:0.001984393; Z-score:0.013006139
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.751170429; Fold-change:0.026061283; Z-score:0.069061993
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430202368; Fold-change:0.065273801; Z-score:0.189511894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.72E-07; Fold-change:0.247094005; Z-score:0.769565514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004434184; Fold-change:0.173059187; Z-score:1.304831103
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037087156; Fold-change:0.369766531; Z-score:1.203259009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.105972787; Fold-change:0.441254712; Z-score:0.95601182
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.040156902; Fold-change:-1.299010556; Z-score:-3.02242415
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238640662; Fold-change:-0.243794285; Z-score:-0.495028005
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.120066734; Fold-change:0.180884846; Z-score:0.548024512
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.57E-08; Fold-change:0.685837603; Z-score:1.729507265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.52033395; Fold-change:-0.049677333; Z-score:-0.299451026
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.492934811; Fold-change:-0.228139948; Z-score:-0.487089048
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.648896572; Fold-change:0.254322148; Z-score:0.482792043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524897319; Fold-change:0.346221838; Z-score:0.61907594
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.860800898; Fold-change:0.155805071; Z-score:0.382573415
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.751170429; Fold-change:0.026061283; Z-score:0.069061993
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430202368; Fold-change:0.065273801; Z-score:0.189511894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.72E-07; Fold-change:0.247094005; Z-score:0.769565514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004434184; Fold-change:0.173059187; Z-score:1.304831103
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037087156; Fold-change:0.369766531; Z-score:1.203259009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.105972787; Fold-change:0.441254712; Z-score:0.95601182
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.040156902; Fold-change:-1.299010556; Z-score:-3.02242415
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238640662; Fold-change:-0.243794285; Z-score:-0.495028005
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.120066734; Fold-change:0.180884846; Z-score:0.548024512
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.57E-08; Fold-change:0.685837603; Z-score:1.729507265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.52033395; Fold-change:-0.049677333; Z-score:-0.299451026
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.492934811; Fold-change:-0.228139948; Z-score:-0.487089048
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.648896572; Fold-change:0.254322148; Z-score:0.482792043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524897319; Fold-change:0.346221838; Z-score:0.61907594
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.860800898; Fold-change:0.155805071; Z-score:0.382573415
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.751170429; Fold-change:0.026061283; Z-score:0.069061993
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430202368; Fold-change:0.065273801; Z-score:0.189511894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.72E-07; Fold-change:0.247094005; Z-score:0.769565514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004434184; Fold-change:0.173059187; Z-score:1.304831103
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037087156; Fold-change:0.369766531; Z-score:1.203259009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.105972787; Fold-change:0.441254712; Z-score:0.95601182
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.040156902; Fold-change:-1.299010556; Z-score:-3.02242415
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238640662; Fold-change:-0.243794285; Z-score:-0.495028005
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.120066734; Fold-change:0.180884846; Z-score:0.548024512
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.57E-08; Fold-change:0.685837603; Z-score:1.729507265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.52033395; Fold-change:-0.049677333; Z-score:-0.299451026
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.492934811; Fold-change:-0.228139948; Z-score:-0.487089048
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.648896572; Fold-change:0.254322148; Z-score:0.482792043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524897319; Fold-change:0.346221838; Z-score:0.61907594
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.860800898; Fold-change:0.155805071; Z-score:0.382573415
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.751170429; Fold-change:0.026061283; Z-score:0.069061993
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430202368; Fold-change:0.065273801; Z-score:0.189511894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.72E-07; Fold-change:0.247094005; Z-score:0.769565514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004434184; Fold-change:0.173059187; Z-score:1.304831103
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037087156; Fold-change:0.369766531; Z-score:1.203259009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.105972787; Fold-change:0.441254712; Z-score:0.95601182
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.040156902; Fold-change:-1.299010556; Z-score:-3.02242415
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238640662; Fold-change:-0.243794285; Z-score:-0.495028005
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.120066734; Fold-change:0.180884846; Z-score:0.548024512
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.57E-08; Fold-change:0.685837603; Z-score:1.729507265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.52033395; Fold-change:-0.049677333; Z-score:-0.299451026
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.492934811; Fold-change:-0.228139948; Z-score:-0.487089048
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.648896572; Fold-change:0.254322148; Z-score:0.482792043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524897319; Fold-change:0.346221838; Z-score:0.61907594
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.860800898; Fold-change:0.155805071; Z-score:0.382573415
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.751170429; Fold-change:0.026061283; Z-score:0.069061993
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430202368; Fold-change:0.065273801; Z-score:0.189511894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.72E-07; Fold-change:0.247094005; Z-score:0.769565514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004434184; Fold-change:0.173059187; Z-score:1.304831103
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037087156; Fold-change:0.369766531; Z-score:1.203259009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.105972787; Fold-change:0.441254712; Z-score:0.95601182
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.040156902; Fold-change:-1.299010556; Z-score:-3.02242415
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238640662; Fold-change:-0.243794285; Z-score:-0.495028005
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.120066734; Fold-change:0.180884846; Z-score:0.548024512
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.57E-08; Fold-change:0.685837603; Z-score:1.729507265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.52033395; Fold-change:-0.049677333; Z-score:-0.299451026
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.492934811; Fold-change:-0.228139948; Z-score:-0.487089048
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.648896572; Fold-change:0.254322148; Z-score:0.482792043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524897319; Fold-change:0.346221838; Z-score:0.61907594
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.860800898; Fold-change:0.155805071; Z-score:0.382573415
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.751170429; Fold-change:0.026061283; Z-score:0.069061993
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430202368; Fold-change:0.065273801; Z-score:0.189511894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.72E-07; Fold-change:0.247094005; Z-score:0.769565514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004434184; Fold-change:0.173059187; Z-score:1.304831103
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037087156; Fold-change:0.369766531; Z-score:1.203259009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.105972787; Fold-change:0.441254712; Z-score:0.95601182
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.040156902; Fold-change:-1.299010556; Z-score:-3.02242415
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238640662; Fold-change:-0.243794285; Z-score:-0.495028005
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.120066734; Fold-change:0.180884846; Z-score:0.548024512
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.57E-08; Fold-change:0.685837603; Z-score:1.729507265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.52033395; Fold-change:-0.049677333; Z-score:-0.299451026
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.492934811; Fold-change:-0.228139948; Z-score:-0.487089048
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.648896572; Fold-change:0.254322148; Z-score:0.482792043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524897319; Fold-change:0.346221838; Z-score:0.61907594
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.860800898; Fold-change:0.155805071; Z-score:0.382573415
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.751170429; Fold-change:0.026061283; Z-score:0.069061993
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430202368; Fold-change:0.065273801; Z-score:0.189511894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.72E-07; Fold-change:0.247094005; Z-score:0.769565514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004434184; Fold-change:0.173059187; Z-score:1.304831103
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037087156; Fold-change:0.369766531; Z-score:1.203259009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.105972787; Fold-change:0.441254712; Z-score:0.95601182
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.040156902; Fold-change:-1.299010556; Z-score:-3.02242415
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238640662; Fold-change:-0.243794285; Z-score:-0.495028005
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.120066734; Fold-change:0.180884846; Z-score:0.548024512
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.57E-08; Fold-change:0.685837603; Z-score:1.729507265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.52033395; Fold-change:-0.049677333; Z-score:-0.299451026
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.492934811; Fold-change:-0.228139948; Z-score:-0.487089048
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.648896572; Fold-change:0.254322148; Z-score:0.482792043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524897319; Fold-change:0.346221838; Z-score:0.61907594
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.860800898; Fold-change:0.155805071; Z-score:0.382573415
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.751170429; Fold-change:0.026061283; Z-score:0.069061993
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430202368; Fold-change:0.065273801; Z-score:0.189511894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.72E-07; Fold-change:0.247094005; Z-score:0.769565514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004434184; Fold-change:0.173059187; Z-score:1.304831103
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037087156; Fold-change:0.369766531; Z-score:1.203259009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.105972787; Fold-change:0.441254712; Z-score:0.95601182
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.040156902; Fold-change:-1.299010556; Z-score:-3.02242415
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238640662; Fold-change:-0.243794285; Z-score:-0.495028005
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.120066734; Fold-change:0.180884846; Z-score:0.548024512
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.57E-08; Fold-change:0.685837603; Z-score:1.729507265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.52033395; Fold-change:-0.049677333; Z-score:-0.299451026
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.492934811; Fold-change:-0.228139948; Z-score:-0.487089048
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.648896572; Fold-change:0.254322148; Z-score:0.482792043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524897319; Fold-change:0.346221838; Z-score:0.61907594
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.860800898; Fold-change:0.155805071; Z-score:0.382573415
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.751170429; Fold-change:0.026061283; Z-score:0.069061993
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430202368; Fold-change:0.065273801; Z-score:0.189511894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.72E-07; Fold-change:0.247094005; Z-score:0.769565514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004434184; Fold-change:0.173059187; Z-score:1.304831103
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037087156; Fold-change:0.369766531; Z-score:1.203259009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.105972787; Fold-change:0.441254712; Z-score:0.95601182
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.040156902; Fold-change:-1.299010556; Z-score:-3.02242415
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238640662; Fold-change:-0.243794285; Z-score:-0.495028005
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.120066734; Fold-change:0.180884846; Z-score:0.548024512
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.57E-08; Fold-change:0.685837603; Z-score:1.729507265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.52033395; Fold-change:-0.049677333; Z-score:-0.299451026
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.492934811; Fold-change:-0.228139948; Z-score:-0.487089048
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.648896572; Fold-change:0.254322148; Z-score:0.482792043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524897319; Fold-change:0.346221838; Z-score:0.61907594
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.860800898; Fold-change:0.155805071; Z-score:0.382573415
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.751170429; Fold-change:0.026061283; Z-score:0.069061993
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430202368; Fold-change:0.065273801; Z-score:0.189511894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.72E-07; Fold-change:0.247094005; Z-score:0.769565514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004434184; Fold-change:0.173059187; Z-score:1.304831103
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037087156; Fold-change:0.369766531; Z-score:1.203259009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.105972787; Fold-change:0.441254712; Z-score:0.95601182
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.040156902; Fold-change:-1.299010556; Z-score:-3.02242415
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238640662; Fold-change:-0.243794285; Z-score:-0.495028005
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.120066734; Fold-change:0.180884846; Z-score:0.548024512
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.57E-08; Fold-change:0.685837603; Z-score:1.729507265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.52033395; Fold-change:-0.049677333; Z-score:-0.299451026
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.492934811; Fold-change:-0.228139948; Z-score:-0.487089048
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.648896572; Fold-change:0.254322148; Z-score:0.482792043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524897319; Fold-change:0.346221838; Z-score:0.61907594
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.860800898; Fold-change:0.155805071; Z-score:0.382573415
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.751170429; Fold-change:0.026061283; Z-score:0.069061993
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430202368; Fold-change:0.065273801; Z-score:0.189511894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.72E-07; Fold-change:0.247094005; Z-score:0.769565514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004434184; Fold-change:0.173059187; Z-score:1.304831103
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037087156; Fold-change:0.369766531; Z-score:1.203259009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.105972787; Fold-change:0.441254712; Z-score:0.95601182
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.040156902; Fold-change:-1.299010556; Z-score:-3.02242415
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238640662; Fold-change:-0.243794285; Z-score:-0.495028005
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.120066734; Fold-change:0.180884846; Z-score:0.548024512
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.57E-08; Fold-change:0.685837603; Z-score:1.729507265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.52033395; Fold-change:-0.049677333; Z-score:-0.299451026
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.492934811; Fold-change:-0.228139948; Z-score:-0.487089048
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.648896572; Fold-change:0.254322148; Z-score:0.482792043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524897319; Fold-change:0.346221838; Z-score:0.61907594
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.860800898; Fold-change:0.155805071; Z-score:0.382573415
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.751170429; Fold-change:0.026061283; Z-score:0.069061993
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430202368; Fold-change:0.065273801; Z-score:0.189511894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.72E-07; Fold-change:0.247094005; Z-score:0.769565514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004434184; Fold-change:0.173059187; Z-score:1.304831103
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037087156; Fold-change:0.369766531; Z-score:1.203259009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.105972787; Fold-change:0.441254712; Z-score:0.95601182
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.040156902; Fold-change:-1.299010556; Z-score:-3.02242415
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238640662; Fold-change:-0.243794285; Z-score:-0.495028005
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.120066734; Fold-change:0.180884846; Z-score:0.548024512
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.57E-08; Fold-change:0.685837603; Z-score:1.729507265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.52033395; Fold-change:-0.049677333; Z-score:-0.299451026
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.492934811; Fold-change:-0.228139948; Z-score:-0.487089048
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.648896572; Fold-change:0.254322148; Z-score:0.482792043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524897319; Fold-change:0.346221838; Z-score:0.61907594
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.860800898; Fold-change:0.155805071; Z-score:0.382573415
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.751170429; Fold-change:0.026061283; Z-score:0.069061993
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.430202368; Fold-change:0.065273801; Z-score:0.189511894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.72E-07; Fold-change:0.247094005; Z-score:0.769565514
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004434184; Fold-change:0.173059187; Z-score:1.304831103
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.037087156; Fold-change:0.369766531; Z-score:1.203259009
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.105972787; Fold-change:0.441254712; Z-score:0.95601182
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.040156902; Fold-change:-1.299010556; Z-score:-3.02242415
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238640662; Fold-change:-0.243794285; Z-score:-0.495028005
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.120066734; Fold-change:0.180884846; Z-score:0.548024512
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.57E-08; Fold-change:0.685837603; Z-score:1.729507265
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.52033395; Fold-change:-0.049677333; Z-score:-0.299451026
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.492934811; Fold-change:-0.228139948; Z-score:-0.487089048
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.648896572; Fold-change:0.254322148; Z-score:0.482792043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524897319; Fold-change:0.346221838; Z-score:0.61907594
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.860800898; Fold-change:0.155805071; Z-score:0.382573415
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 09 Disease of the visual system
             [+] ICD-11: 9A96 Anterior uveitis Click to Show/Hide the Full List
The Studied Tissue Peripheral monocyte
The Specified Disease Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.324103269; Fold-change:0.174187504; Z-score:1.130759721
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:0.881399556; Z-score:1.212298038
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.647883621; Fold-change:0.002398657; Z-score:0.006181772
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050770889; Fold-change:0.137814671; Z-score:0.54871906
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:0.881399556; Z-score:1.212298038
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.647883621; Fold-change:0.002398657; Z-score:0.006181772
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050770889; Fold-change:0.137814671; Z-score:0.54871906
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:0.881399556; Z-score:1.212298038
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.647883621; Fold-change:0.002398657; Z-score:0.006181772
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050770889; Fold-change:0.137814671; Z-score:0.54871906
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.286232196; Fold-change:-0.083578007; Z-score:-0.243982778
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.186694565; Fold-change:-0.264574013; Z-score:-1.03149368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.549852151; Fold-change:-0.216352379; Z-score:-0.706228322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.271953529; Fold-change:-0.04002249; Z-score:-0.116286116
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.520621246; Fold-change:-0.178627242; Z-score:-0.344213431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001959927; Fold-change:-0.467769513; Z-score:-0.528057328
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.149244511; Fold-change:-0.110032633; Z-score:-0.357375343
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.286232196; Fold-change:-0.083578007; Z-score:-0.243982778
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.186694565; Fold-change:-0.264574013; Z-score:-1.03149368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.549852151; Fold-change:-0.216352379; Z-score:-0.706228322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.271953529; Fold-change:-0.04002249; Z-score:-0.116286116
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.520621246; Fold-change:-0.178627242; Z-score:-0.344213431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001959927; Fold-change:-0.467769513; Z-score:-0.528057328
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.149244511; Fold-change:-0.110032633; Z-score:-0.357375343
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.286232196; Fold-change:-0.083578007; Z-score:-0.243982778
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.186694565; Fold-change:-0.264574013; Z-score:-1.03149368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.549852151; Fold-change:-0.216352379; Z-score:-0.706228322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.271953529; Fold-change:-0.04002249; Z-score:-0.116286116
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.520621246; Fold-change:-0.178627242; Z-score:-0.344213431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001959927; Fold-change:-0.467769513; Z-score:-0.528057328
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.149244511; Fold-change:-0.110032633; Z-score:-0.357375343
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.286232196; Fold-change:-0.083578007; Z-score:-0.243982778
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.186694565; Fold-change:-0.264574013; Z-score:-1.03149368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.549852151; Fold-change:-0.216352379; Z-score:-0.706228322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.271953529; Fold-change:-0.04002249; Z-score:-0.116286116
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.520621246; Fold-change:-0.178627242; Z-score:-0.344213431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001959927; Fold-change:-0.467769513; Z-score:-0.528057328
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.149244511; Fold-change:-0.110032633; Z-score:-0.357375343
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.286232196; Fold-change:-0.083578007; Z-score:-0.243982778
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.186694565; Fold-change:-0.264574013; Z-score:-1.03149368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.549852151; Fold-change:-0.216352379; Z-score:-0.706228322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.271953529; Fold-change:-0.04002249; Z-score:-0.116286116
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.520621246; Fold-change:-0.178627242; Z-score:-0.344213431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001959927; Fold-change:-0.467769513; Z-score:-0.528057328
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.149244511; Fold-change:-0.110032633; Z-score:-0.357375343
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.286232196; Fold-change:-0.083578007; Z-score:-0.243982778
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.186694565; Fold-change:-0.264574013; Z-score:-1.03149368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.549852151; Fold-change:-0.216352379; Z-score:-0.706228322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.271953529; Fold-change:-0.04002249; Z-score:-0.116286116
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.520621246; Fold-change:-0.178627242; Z-score:-0.344213431
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001959927; Fold-change:-0.467769513; Z-score:-0.528057328
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.149244511; Fold-change:-0.110032633; Z-score:-0.357375343
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.427908686; Fold-change:0.0790499; Z-score:0.213024942
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.148454995; Fold-change:-0.132236699; Z-score:-1.085087426
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.393770536; Fold-change:0.230980952; Z-score:0.592132073
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.29E-07; Fold-change:-1.164589745; Z-score:-4.394431493
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.003478626; Fold-change:0.25601996; Z-score:0.522946701
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.216736307; Fold-change:-0.164955879; Z-score:-0.340006472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.427908686; Fold-change:0.0790499; Z-score:0.213024942
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.148454995; Fold-change:-0.132236699; Z-score:-1.085087426
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.393770536; Fold-change:0.230980952; Z-score:0.592132073
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.29E-07; Fold-change:-1.164589745; Z-score:-4.394431493
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.003478626; Fold-change:0.25601996; Z-score:0.522946701
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.216736307; Fold-change:-0.164955879; Z-score:-0.340006472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.427908686; Fold-change:0.0790499; Z-score:0.213024942
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.148454995; Fold-change:-0.132236699; Z-score:-1.085087426
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.393770536; Fold-change:0.230980952; Z-score:0.592132073
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.29E-07; Fold-change:-1.164589745; Z-score:-4.394431493
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.003478626; Fold-change:0.25601996; Z-score:0.522946701
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.216736307; Fold-change:-0.164955879; Z-score:-0.340006472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.427908686; Fold-change:0.0790499; Z-score:0.213024942
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.148454995; Fold-change:-0.132236699; Z-score:-1.085087426
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.393770536; Fold-change:0.230980952; Z-score:0.592132073
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.29E-07; Fold-change:-1.164589745; Z-score:-4.394431493
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.003478626; Fold-change:0.25601996; Z-score:0.522946701
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.216736307; Fold-change:-0.164955879; Z-score:-0.340006472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.427908686; Fold-change:0.0790499; Z-score:0.213024942
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.148454995; Fold-change:-0.132236699; Z-score:-1.085087426
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.393770536; Fold-change:0.230980952; Z-score:0.592132073
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.29E-07; Fold-change:-1.164589745; Z-score:-4.394431493
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.003478626; Fold-change:0.25601996; Z-score:0.522946701
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.216736307; Fold-change:-0.164955879; Z-score:-0.340006472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.427908686; Fold-change:0.0790499; Z-score:0.213024942
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.148454995; Fold-change:-0.132236699; Z-score:-1.085087426
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.393770536; Fold-change:0.230980952; Z-score:0.592132073
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:9.29E-07; Fold-change:-1.164589745; Z-score:-4.394431493
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.003478626; Fold-change:0.25601996; Z-score:0.522946701
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.216736307; Fold-change:-0.164955879; Z-score:-0.340006472
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0483785; Fold-change:0.006026051; Z-score:0.012298228
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:0.170630921; Z-score:0.450240883
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.54E-41; Fold-change:1.198070368; Z-score:2.263282566
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.877999582; Fold-change:-0.072722965; Z-score:-0.22815117
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.112543017; Fold-change:-0.094041871; Z-score:-0.246042707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.578293048; Fold-change:0.190623235; Z-score:0.830865111
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0483785; Fold-change:0.006026051; Z-score:0.012298228
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:0.170630921; Z-score:0.450240883
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.54E-41; Fold-change:1.198070368; Z-score:2.263282566
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.877999582; Fold-change:-0.072722965; Z-score:-0.22815117
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.112543017; Fold-change:-0.094041871; Z-score:-0.246042707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.578293048; Fold-change:0.190623235; Z-score:0.830865111
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0483785; Fold-change:0.006026051; Z-score:0.012298228
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:0.170630921; Z-score:0.450240883
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.54E-41; Fold-change:1.198070368; Z-score:2.263282566
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.877999582; Fold-change:-0.072722965; Z-score:-0.22815117
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.112543017; Fold-change:-0.094041871; Z-score:-0.246042707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.578293048; Fold-change:0.190623235; Z-score:0.830865111
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0483785; Fold-change:0.006026051; Z-score:0.012298228
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:0.170630921; Z-score:0.450240883
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.54E-41; Fold-change:1.198070368; Z-score:2.263282566
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.877999582; Fold-change:-0.072722965; Z-score:-0.22815117
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.112543017; Fold-change:-0.094041871; Z-score:-0.246042707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.578293048; Fold-change:0.190623235; Z-score:0.830865111
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.0483785; Fold-change:0.006026051; Z-score:0.012298228
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.65E-06; Fold-change:0.170630921; Z-score:0.450240883
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.54E-41; Fold-change:1.198070368; Z-score:2.263282566
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.877999582; Fold-change:-0.072722965; Z-score:-0.22815117
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.112543017; Fold-change:-0.094041871; Z-score:-0.246042707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.578293048; Fold-change:0.190623235; Z-score:0.830865111
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.05152258; Fold-change:0.12067992; Z-score:0.497393538
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.467940207; Fold-change:0.20491942; Z-score:0.21644043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.99E-07; Fold-change:1.507205369; Z-score:5.145450359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.914563843; Fold-change:-0.155310863; Z-score:-0.196598046
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238232491; Fold-change:-0.221578098; Z-score:-1.273681355
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.034943939; Fold-change:0.264286487; Z-score:2.289975109
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.05152258; Fold-change:0.12067992; Z-score:0.497393538
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.467940207; Fold-change:0.20491942; Z-score:0.21644043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.99E-07; Fold-change:1.507205369; Z-score:5.145450359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.914563843; Fold-change:-0.155310863; Z-score:-0.196598046
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238232491; Fold-change:-0.221578098; Z-score:-1.273681355
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.034943939; Fold-change:0.264286487; Z-score:2.289975109
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.05152258; Fold-change:0.12067992; Z-score:0.497393538
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.467940207; Fold-change:0.20491942; Z-score:0.21644043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.99E-07; Fold-change:1.507205369; Z-score:5.145450359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.914563843; Fold-change:-0.155310863; Z-score:-0.196598046
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238232491; Fold-change:-0.221578098; Z-score:-1.273681355
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.034943939; Fold-change:0.264286487; Z-score:2.289975109
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.05152258; Fold-change:0.12067992; Z-score:0.497393538
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.467940207; Fold-change:0.20491942; Z-score:0.21644043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.99E-07; Fold-change:1.507205369; Z-score:5.145450359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.914563843; Fold-change:-0.155310863; Z-score:-0.196598046
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238232491; Fold-change:-0.221578098; Z-score:-1.273681355
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.034943939; Fold-change:0.264286487; Z-score:2.289975109
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.05152258; Fold-change:0.12067992; Z-score:0.497393538
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.467940207; Fold-change:0.20491942; Z-score:0.21644043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.99E-07; Fold-change:1.507205369; Z-score:5.145450359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.914563843; Fold-change:-0.155310863; Z-score:-0.196598046
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238232491; Fold-change:-0.221578098; Z-score:-1.273681355
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.034943939; Fold-change:0.264286487; Z-score:2.289975109
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.05152258; Fold-change:0.12067992; Z-score:0.497393538
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.467940207; Fold-change:0.20491942; Z-score:0.21644043
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.99E-07; Fold-change:1.507205369; Z-score:5.145450359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.914563843; Fold-change:-0.155310863; Z-score:-0.196598046
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.238232491; Fold-change:-0.221578098; Z-score:-1.273681355
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.034943939; Fold-change:0.264286487; Z-score:2.289975109
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 16 Disease of the genitourinary system
             [+] ICD-11: GA10 Endometriosis Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00134641; Fold-change:0.526714108; Z-score:1.334930915
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: GC00 Cystitis Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000331473; Fold-change:0.703768335; Z-score:3.616839273
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 16 Disease of the genitourinary system
             [+] ICD-11: GA10 Endometriosis Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00134641; Fold-change:0.526714108; Z-score:1.334930915
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: GC00 Cystitis Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000331473; Fold-change:0.703768335; Z-score:3.616839273
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 19 Certain condition originating in the perinatal period
             [+] ICD-11: KA21 Short gestation disorder Click to Show/Hide the Full List
The Studied Tissue Myometrium
The Specified Disease Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.158892886; Fold-change:-0.466217308; Z-score:-0.809340322
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 20 Developmental anomaly
             [+] ICD-11: LD2C Overgrowth syndrome Click to Show/Hide the Full List
The Studied Tissue Adipose tissue
The Specified Disease Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.478297658; Fold-change:-0.034990246; Z-score:-0.27114146
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Perituberal tissue
The Specified Disease Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.44725588; Fold-change:0.25268881; Z-score:0.709596984
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 20 Developmental anomaly
             [+] ICD-11: LD2C Overgrowth syndrome Click to Show/Hide the Full List
The Studied Tissue Adipose tissue
The Specified Disease Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.478297658; Fold-change:-0.034990246; Z-score:-0.27114146
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Perituberal tissue
The Specified Disease Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.44725588; Fold-change:0.25268881; Z-score:0.709596984
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
References
1 STAT3 regulates ABCA3 expression and influences lamellar body formation in alveolar type II cells. Am J Respir Cell Mol Biol. 2008 May;38(5):551-8.
2 The p-STAT3/ANXA2 axis promotes caspase-1-mediated hepatocyte pyroptosis in non-alcoholic steatohepatitis. J Transl Med. 2022 Nov 2;20(1):497.
3 CD109 Promotes Drug Resistance in A2780 Ovarian Cancer Cells by Regulating the STAT3-NOTCH1 Signaling Axis. Int J Mol Sci. 2023 Jun 18;24(12):10306.
4 Insulin secretory defects and impaired islet architecture in pancreatic beta-cell-specific STAT3 knockout mice. Biochem Biophys Res Commun. 2004 Jul 9;319(4):1159-70.
5 Human macrophage differentiation induces OCTN2-mediated L-carnitine transport through stimulation of mTOR-STAT3 axis. J Leukoc Biol. 2017 Mar;101(3):665-674.
6 Sodium butyrate increases P-gp expression in lung cancer by upregulation of STAT3 and mRNA stabilization of ABCB1. Anticancer Drugs. 2018 Mar;29(3):227-233.
7 Novel application of rhein and its prodrug diacerein for reversing cancer-related multidrug resistance through the dual inhibition of P-glycoprotein efflux and STAT3-mediated P-glycoprotein expression. Biomed Pharmacother. 2022 Jun;150:112995.
8 Cell confluency-induced Stat3 activation regulates NHE3 expression by recruiting Sp1 and Sp3 to the proximal NHE3 promoter region during epithelial dome formation. Am J Physiol Cell Physiol. 2009 Jan;296(1):C13-24.
9 Nasal Colivelin treatment ameliorates memory impairment related to Alzheimer's disease. Neuropsychopharmacology. 2008 Jul;33(8):2020-32.
10 The critical role of the zinc transporter Zip2 (SLC39A2) in ischemia/reperfusion injury in mouse hearts. J Mol Cell Cardiol. 2019 Jul;132:136-145.
11 hTFtarget: A Comprehensive Database for Regulations of Human Transcription Factors and Their Targets. Genomics Proteomics Bioinformatics. 2020 Apr;18(2):120-469.

If you find any error in data or bug in web service, please kindly report it to Dr. Li and Dr. Fu.