General Information of This TF
TF ID
TFD0034
TF name
ETS translocation variant 4 (ETV4)
Synonyms
Adenovirus E1A enhancer-binding protein; E1A-F; E1AF; ETV4; PEA3; Polyomavirus enhancer activator 3 homolog; Protein PEA3
Gene Name
ETV4
Gene ID
2118
TF Classification Superclass Helix-turn-helix domains
Class Tryptophan cluster factors
Family Ets-related factors
Subfamily Elk-like factors
Function This transcription factor acts as a transcriptional activator with a core binding sequence of 5'-[AC]GGA[AT]GT-3'.
Sequence
MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMDPGSLPPLDSEDLFQDLSHF
QETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHH
GEQCLYSSAYDPPRQIAIKSPAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYLGE
HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQP
AVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGYE
KPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFI
AWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF
VCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKG
GYSY
Uniprot ID
ETV4_HUMAN
Ensembl ID
ENSG00000175832
HGNC ID
HGNC:3493
JASPAR ID
MA0764.1
TF Binding Frequency Matrix TFD0034
Drug Transporter(s) Regulated by This TF

Activation

VGLUT3

Transporter Info

Heallth [ICD11: N.A]

[1]
Disease-specific Protein Abundances of TF
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.92E-05; Fold-change:0.177157604; Z-score:0.748779138
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013189526; Fold-change:0.360033703; Z-score:9.357248073
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.260890579; Fold-change:-0.034943073; Z-score:-0.449102144
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.594189368; Fold-change:0.003645259; Z-score:0.012205506
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.875571655; Fold-change:-0.05513296; Z-score:-0.425204367
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.797708699; Fold-change:-0.009501961; Z-score:-0.056519977
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.743518716; Fold-change:-0.026566386; Z-score:-0.089171774
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.92E-05; Fold-change:0.177157604; Z-score:0.748779138
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013189526; Fold-change:0.360033703; Z-score:9.357248073
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.260890579; Fold-change:-0.034943073; Z-score:-0.449102144
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.594189368; Fold-change:0.003645259; Z-score:0.012205506
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.875571655; Fold-change:-0.05513296; Z-score:-0.425204367
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.797708699; Fold-change:-0.009501961; Z-score:-0.056519977
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.743518716; Fold-change:-0.026566386; Z-score:-0.089171774
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.92E-05; Fold-change:0.177157604; Z-score:0.748779138
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013189526; Fold-change:0.360033703; Z-score:9.357248073
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.260890579; Fold-change:-0.034943073; Z-score:-0.449102144
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.594189368; Fold-change:0.003645259; Z-score:0.012205506
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.875571655; Fold-change:-0.05513296; Z-score:-0.425204367
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.797708699; Fold-change:-0.009501961; Z-score:-0.056519977
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.743518716; Fold-change:-0.026566386; Z-score:-0.089171774
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.92E-05; Fold-change:0.177157604; Z-score:0.748779138
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013189526; Fold-change:0.360033703; Z-score:9.357248073
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.260890579; Fold-change:-0.034943073; Z-score:-0.449102144
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.594189368; Fold-change:0.003645259; Z-score:0.012205506
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.875571655; Fold-change:-0.05513296; Z-score:-0.425204367
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.797708699; Fold-change:-0.009501961; Z-score:-0.056519977
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.743518716; Fold-change:-0.026566386; Z-score:-0.089171774
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.92E-05; Fold-change:0.177157604; Z-score:0.748779138
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013189526; Fold-change:0.360033703; Z-score:9.357248073
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.260890579; Fold-change:-0.034943073; Z-score:-0.449102144
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.594189368; Fold-change:0.003645259; Z-score:0.012205506
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.875571655; Fold-change:-0.05513296; Z-score:-0.425204367
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.797708699; Fold-change:-0.009501961; Z-score:-0.056519977
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.743518716; Fold-change:-0.026566386; Z-score:-0.089171774
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.92E-05; Fold-change:0.177157604; Z-score:0.748779138
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013189526; Fold-change:0.360033703; Z-score:9.357248073
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.260890579; Fold-change:-0.034943073; Z-score:-0.449102144
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.594189368; Fold-change:0.003645259; Z-score:0.012205506
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.875571655; Fold-change:-0.05513296; Z-score:-0.425204367
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.797708699; Fold-change:-0.009501961; Z-score:-0.056519977
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.743518716; Fold-change:-0.026566386; Z-score:-0.089171774
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 01 Certain infectious or parasitic disease
             [+] ICD-11: 1C1H Necrotising ulcerative gingivitis Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Bacterial infection of gingival [ICD-11:1C1H]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.92E-05; Fold-change:0.177157604; Z-score:0.748779138
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E30 Influenza Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Influenza [ICD-11:1.00E+30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.013189526; Fold-change:0.360033703; Z-score:9.357248073
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1E51 Chronic viral hepatitis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Chronic hepatitis C [ICD-11:1E51.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.260890579; Fold-change:-0.034943073; Z-score:-0.449102144
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 1G41 Sepsis with septic shock Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Sepsis with septic shock [ICD-11:1G41]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.594189368; Fold-change:0.003645259; Z-score:0.012205506
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA40 Respiratory syncytial virus infection Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Pediatric respiratory syncytial virus infection [ICD-11:CA40.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.875571655; Fold-change:-0.05513296; Z-score:-0.425204367
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA42 Rhinovirus infection Click to Show/Hide the Full List
The Studied Tissue Nasal epithelium tissue
The Specified Disease Rhinovirus infection [ICD-11:CA42.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.797708699; Fold-change:-0.009501961; Z-score:-0.056519977
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: KA60 Neonatal sepsis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Neonatal sepsis [ICD-11:KA60]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.743518716; Fold-change:-0.026566386; Z-score:-0.089171774
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 02 Neoplasm
             [+] ICD-11: 2A00 Brain cancer Click to Show/Hide the Full List
The Studied Tissue Nervous tissue
The Specified Disease Glioblastopma [ICD-11:2A00.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.11E-28; Fold-change:0.121273698; Z-score:0.445231789
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002573338; Fold-change:0.179310091; Z-score:4.003775619
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue White matter tissue
The Specified Disease Glioma [ICD-11:2A00.0Y-2A00.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.019148861; Fold-change:-0.155472522; Z-score:-0.97746724
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Brain stem tissue
The Specified Disease Neuroectodermal tumour [ICD-11:2A00.11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.903277995; Fold-change:-0.324246793; Z-score:-0.93455022
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A20 Myeloproliferative neoplasm Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Myelofibrosis [ICD-11:2A20.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.084139032; Fold-change:0.098988557; Z-score:0.61200767
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Polycythemia vera [ICD-11:2A20.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:5.72E-06; Fold-change:0.204494996; Z-score:1.33063368
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A36 Myelodysplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Myelodysplastic syndrome [ICD-11:2A36-2A3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.223947162; Fold-change:0.038858323; Z-score:0.266930133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.080152347; Fold-change:-0.15027267; Z-score:-1.150594888
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A81 Diffuse large B-cell lymphoma Click to Show/Hide the Full List
The Studied Tissue Tonsil tissue
The Specified Disease Diffuse large B-cell lymphoma [ICD-11:2A81]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858296549; Fold-change:-0.015299002; Z-score:-0.11980482
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2A83 Plasma cell neoplasm Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.792780773; Fold-change:-0.071509027; Z-score:-0.31282686
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Bone marrow
The Specified Disease Multiple myeloma [ICD-11:2A83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.75380552; Fold-change:-0.07714145; Z-score:-0.318940707
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B33 Leukaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Acute myelocytic leukaemia [ICD-11:2B33.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.044853838; Fold-change:0.090424029; Z-score:0.443794076
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B6E Oral cancer Click to Show/Hide the Full List
The Studied Tissue Oral tissue
The Specified Disease Oral cancer [ICD-11:2B6E]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.224742636; Fold-change:-0.116647209; Z-score:-0.619603173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.62E-18; Fold-change:0.385754012; Z-score:1.586644992
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B70 Esophageal cancer Click to Show/Hide the Full List
The Studied Tissue Esophagus
The Specified Disease Esophagal cancer [ICD-11:2B70]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.688116313; Fold-change:-0.03801555; Z-score:-0.101371446
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B72 Stomach cancer Click to Show/Hide the Full List
The Studied Tissue Gastric tissue
The Specified Disease Gastric cancer [ICD-11:2B72]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004633261; Fold-change:0.41986384; Z-score:3.53367407
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:1.57E-07; Fold-change:0.662561796; Z-score:1.725841503
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B90 Colon cancer Click to Show/Hide the Full List
The Studied Tissue Colon tissue
The Specified Disease Colon cancer [ICD-11:2B90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.16E-217; Fold-change:1.703100783; Z-score:6.165222086
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.49E-150; Fold-change:1.776000604; Z-score:5.624331181
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2B92 Rectal cancer Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Rectal cancer [ICD-11:2B92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:4.70E-09; Fold-change:1.821113301; Z-score:7.61954585
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.07E-24; Fold-change:1.738636867; Z-score:15.26639271
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C10 Pancreatic cancer Click to Show/Hide the Full List
The Studied Tissue Pancreas
The Specified Disease Pancreatic cancer [ICD-11:2C10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.17430633; Fold-change:0.074638043; Z-score:0.164902815
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.001747142; Fold-change:0.224550748; Z-score:0.545224983
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C12 Liver cancer Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver cancer [ICD-11:2C12.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-16; Fold-change:0.296124162; Z-score:1.017220932
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.94E-27; Fold-change:0.326705999; Z-score:0.906731855
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.000698079; Fold-change:0.47960073; Z-score:2.997770868
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C25 Lung cancer Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Lung cancer [ICD-11:2C25]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.55E-164; Fold-change:0.858147237; Z-score:4.007010434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:5.28E-46; Fold-change:0.735826661; Z-score:1.790587981
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C30 Skin cancer Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Melanoma [ICD-11:2C30]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:8.42E-08; Fold-change:0.785020488; Z-score:1.31473894
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Skin
The Specified Disease Skin cancer [ICD-11:2C30-2C3Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.30E-37; Fold-change:0.583350131; Z-score:1.475847216
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.84E-74; Fold-change:1.192314; Z-score:3.347018269
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C6Z Breast cancer Click to Show/Hide the Full List
The Studied Tissue Breast tissue
The Specified Disease Breast cancer [ICD-11:2C60-2C6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.234433706; Fold-change:0.007216579; Z-score:0.014748336
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.050665184; Fold-change:-0.226083927; Z-score:-0.427205589
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C73 Ovarian cancer Click to Show/Hide the Full List
The Studied Tissue Ovarian tissue
The Specified Disease Ovarian cancer [ICD-11:2C73]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.54E-06; Fold-change:0.965232982; Z-score:3.019059528
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000156165; Fold-change:1.340406369; Z-score:1.893489753
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C77 Cervical cancer Click to Show/Hide the Full List
The Studied Tissue Cervical tissue
The Specified Disease Cervical cancer [ICD-11:2C77]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.689965591; Fold-change:-0.019976309; Z-score:-0.084009793
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C78 Uterine cancer Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Uterine cancer [ICD-11:2C78]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00765449; Fold-change:0.121272191; Z-score:0.236538006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.000494879; Fold-change:-2.18234242; Z-score:-4.554001985
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C82 Prostate cancer Click to Show/Hide the Full List
The Studied Tissue Prostate
The Specified Disease Prostate cancer [ICD-11:2C82]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.015394227; Fold-change:-0.556351569; Z-score:-1.130366341
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C90 Renal cancer Click to Show/Hide the Full List
The Studied Tissue Kidney
The Specified Disease Renal cancer [ICD-11:2C90-2C91]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.133336215; Fold-change:-0.233476593; Z-score:-0.526499766
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:2.33E-09; Fold-change:-0.449921556; Z-score:-1.778367521
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C92 Ureter cancer Click to Show/Hide the Full List
The Studied Tissue Urothelium
The Specified Disease Ureter cancer [ICD-11:2C92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.579942894; Fold-change:0.036558671; Z-score:0.127551782
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2C94 Bladder cancer Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer [ICD-11:2C94]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:1.31E-15; Fold-change:0.848470694; Z-score:8.38546089
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D02 Retinal cancer Click to Show/Hide the Full List
The Studied Tissue Uvea
The Specified Disease Retinoblastoma [ICD-11:2D02.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.080138077; Fold-change:0.223631238; Z-score:1.120669529
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D10 Thyroid cancer Click to Show/Hide the Full List
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer [ICD-11:2D10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.66E-85; Fold-change:1.343342335; Z-score:5.341221037
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.72E-31; Fold-change:1.411604793; Z-score:3.727569349
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D11 Adrenal cancer Click to Show/Hide the Full List
The Studied Tissue Adrenal cortex
The Specified Disease Adrenocortical carcinoma [ICD-11:2D11.Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.751863913; Fold-change:-0.022731961; Z-score:-0.116235868
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D12 Endocrine gland neoplasm Click to Show/Hide the Full List
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary cancer [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002613543; Fold-change:-0.289850704; Z-score:-0.847466965
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Pituitary tissue
The Specified Disease Pituitary gonadotrope tumour [ICD-11:2D12]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001155858; Fold-change:-0.534248165; Z-score:-1.543644579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 2D42 Head and neck cancer Click to Show/Hide the Full List
The Studied Tissue Head and neck tissue
The Specified Disease Head and neck cancer [ICD-11:2D42]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:3.37E-14; Fold-change:0.366424368; Z-score:1.249039651
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.228284984; Fold-change:0.012150426; Z-score:0.046200535
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.743520416; Fold-change:0.079425146; Z-score:0.499837684
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.138995764; Fold-change:0.016530743; Z-score:0.099944467
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858586421; Fold-change:-0.022241644; Z-score:-0.109040207
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.228284984; Fold-change:0.012150426; Z-score:0.046200535
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.743520416; Fold-change:0.079425146; Z-score:0.499837684
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.138995764; Fold-change:0.016530743; Z-score:0.099944467
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858586421; Fold-change:-0.022241644; Z-score:-0.109040207
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.228284984; Fold-change:0.012150426; Z-score:0.046200535
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.743520416; Fold-change:0.079425146; Z-score:0.499837684
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.138995764; Fold-change:0.016530743; Z-score:0.099944467
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858586421; Fold-change:-0.022241644; Z-score:-0.109040207
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 03 Disease of the blood or blood-forming organs
             [+] ICD-11: 3A51 Sickle cell disorder Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Sickle cell disease [ICD-11:3A51.0-3A51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.228284984; Fold-change:0.012150426; Z-score:0.046200535
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3A70 Aplastic anaemia Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Shwachman-Diamond syndrome [ICD-11:3A70.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.743520416; Fold-change:0.079425146; Z-score:0.499837684
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B63 Thrombocytosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocythemia [ICD-11:3B63]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.138995764; Fold-change:0.016530743; Z-score:0.099944467
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 3B64 Thrombocytopenia Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Thrombocytopenia [ICD-11:3B64]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.858586421; Fold-change:-0.022241644; Z-score:-0.109040207
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.387820021; Fold-change:0.061209683; Z-score:0.514265223
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04579723; Fold-change:-0.131093052; Z-score:-0.247556902
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00997269; Fold-change:0.187545863; Z-score:1.411253727
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.394103011; Fold-change:-0.09073799; Z-score:-0.402860827
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.057826888; Fold-change:-0.472332857; Z-score:-1.419751001
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.772997035; Fold-change:-0.030993941; Z-score:-0.166314973
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.836868159; Fold-change:-0.020814985; Z-score:-0.175386655
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.387820021; Fold-change:0.061209683; Z-score:0.514265223
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04579723; Fold-change:-0.131093052; Z-score:-0.247556902
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00997269; Fold-change:0.187545863; Z-score:1.411253727
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.394103011; Fold-change:-0.09073799; Z-score:-0.402860827
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.057826888; Fold-change:-0.472332857; Z-score:-1.419751001
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.772997035; Fold-change:-0.030993941; Z-score:-0.166314973
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.836868159; Fold-change:-0.020814985; Z-score:-0.175386655
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.387820021; Fold-change:0.061209683; Z-score:0.514265223
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04579723; Fold-change:-0.131093052; Z-score:-0.247556902
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00997269; Fold-change:0.187545863; Z-score:1.411253727
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.394103011; Fold-change:-0.09073799; Z-score:-0.402860827
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.057826888; Fold-change:-0.472332857; Z-score:-1.419751001
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.772997035; Fold-change:-0.030993941; Z-score:-0.166314973
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.836868159; Fold-change:-0.020814985; Z-score:-0.175386655
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.387820021; Fold-change:0.061209683; Z-score:0.514265223
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04579723; Fold-change:-0.131093052; Z-score:-0.247556902
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00997269; Fold-change:0.187545863; Z-score:1.411253727
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.394103011; Fold-change:-0.09073799; Z-score:-0.402860827
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.057826888; Fold-change:-0.472332857; Z-score:-1.419751001
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.772997035; Fold-change:-0.030993941; Z-score:-0.166314973
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.836868159; Fold-change:-0.020814985; Z-score:-0.175386655
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.387820021; Fold-change:0.061209683; Z-score:0.514265223
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04579723; Fold-change:-0.131093052; Z-score:-0.247556902
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00997269; Fold-change:0.187545863; Z-score:1.411253727
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.394103011; Fold-change:-0.09073799; Z-score:-0.402860827
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.057826888; Fold-change:-0.472332857; Z-score:-1.419751001
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.772997035; Fold-change:-0.030993941; Z-score:-0.166314973
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.836868159; Fold-change:-0.020814985; Z-score:-0.175386655
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 04 Disease of the immune system
             [+] ICD-11: 4A00 Immunodeficiency Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Immunodeficiency [ICD-11:4A00-4A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.387820021; Fold-change:0.061209683; Z-score:0.514265223
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A40 Lupus erythematosus Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Lupus erythematosus [ICD-11:4A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.04579723; Fold-change:-0.131093052; Z-score:-0.247556902
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A42 Systemic sclerosis Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Scleroderma [ICD-11:4A42.Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.00997269; Fold-change:0.187545863; Z-score:1.411253727
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A43 Systemic autoimmune disease Click to Show/Hide the Full List
The Studied Tissue Salivary gland tissue
The Specified Disease Sjogren's syndrome [ICD-11:4A43.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.394103011; Fold-change:-0.09073799; Z-score:-0.402860827
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.057826888; Fold-change:-0.472332857; Z-score:-1.419751001
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4A62 Behcet disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Behcet's disease [ICD-11:4A62]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.772997035; Fold-change:-0.030993941; Z-score:-0.166314973
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 4B04 Monocyte count disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autosomal dominant monocytopenia [ICD-11:4B04]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.836868159; Fold-change:-0.020814985; Z-score:-0.175386655
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.53204607; Fold-change:-0.077060867; Z-score:-0.609724378
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.124377941; Fold-change:-0.020234362; Z-score:-0.180505391
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.580384695; Fold-change:-0.053020814; Z-score:-0.480242398
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.891113302; Fold-change:-0.010168907; Z-score:-0.060625309
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.788661172; Fold-change:0.080478535; Z-score:0.267668525
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.216073763; Fold-change:0.106894353; Z-score:0.927335279
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164247924; Fold-change:0.014010494; Z-score:0.095562917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000931866; Fold-change:-0.124160666; Z-score:-0.540345359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.53204607; Fold-change:-0.077060867; Z-score:-0.609724378
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.124377941; Fold-change:-0.020234362; Z-score:-0.180505391
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.580384695; Fold-change:-0.053020814; Z-score:-0.480242398
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.891113302; Fold-change:-0.010168907; Z-score:-0.060625309
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.788661172; Fold-change:0.080478535; Z-score:0.267668525
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.216073763; Fold-change:0.106894353; Z-score:0.927335279
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164247924; Fold-change:0.014010494; Z-score:0.095562917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000931866; Fold-change:-0.124160666; Z-score:-0.540345359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.53204607; Fold-change:-0.077060867; Z-score:-0.609724378
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.124377941; Fold-change:-0.020234362; Z-score:-0.180505391
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.580384695; Fold-change:-0.053020814; Z-score:-0.480242398
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.891113302; Fold-change:-0.010168907; Z-score:-0.060625309
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.788661172; Fold-change:0.080478535; Z-score:0.267668525
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.216073763; Fold-change:0.106894353; Z-score:0.927335279
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164247924; Fold-change:0.014010494; Z-score:0.095562917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000931866; Fold-change:-0.124160666; Z-score:-0.540345359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.53204607; Fold-change:-0.077060867; Z-score:-0.609724378
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.124377941; Fold-change:-0.020234362; Z-score:-0.180505391
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.580384695; Fold-change:-0.053020814; Z-score:-0.480242398
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.891113302; Fold-change:-0.010168907; Z-score:-0.060625309
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.788661172; Fold-change:0.080478535; Z-score:0.267668525
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.216073763; Fold-change:0.106894353; Z-score:0.927335279
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164247924; Fold-change:0.014010494; Z-score:0.095562917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000931866; Fold-change:-0.124160666; Z-score:-0.540345359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.53204607; Fold-change:-0.077060867; Z-score:-0.609724378
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.124377941; Fold-change:-0.020234362; Z-score:-0.180505391
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.580384695; Fold-change:-0.053020814; Z-score:-0.480242398
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.891113302; Fold-change:-0.010168907; Z-score:-0.060625309
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.788661172; Fold-change:0.080478535; Z-score:0.267668525
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.216073763; Fold-change:0.106894353; Z-score:0.927335279
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164247924; Fold-change:0.014010494; Z-score:0.095562917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000931866; Fold-change:-0.124160666; Z-score:-0.540345359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.53204607; Fold-change:-0.077060867; Z-score:-0.609724378
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.124377941; Fold-change:-0.020234362; Z-score:-0.180505391
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.580384695; Fold-change:-0.053020814; Z-score:-0.480242398
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.891113302; Fold-change:-0.010168907; Z-score:-0.060625309
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.788661172; Fold-change:0.080478535; Z-score:0.267668525
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.216073763; Fold-change:0.106894353; Z-score:0.927335279
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164247924; Fold-change:0.014010494; Z-score:0.095562917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000931866; Fold-change:-0.124160666; Z-score:-0.540345359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 05 Endocrine, nutritional or metabolic disease
             [+] ICD-11: 5A11 Type 2 diabetes mellitus Click to Show/Hide the Full List
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.53204607; Fold-change:-0.077060867; Z-score:-0.609724378
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Omental adipose tissue
The Specified Disease Obesity related type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.124377941; Fold-change:-0.020234362; Z-score:-0.180505391
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Liver tissue
The Specified Disease Type 2 diabetes [ICD-11:5A11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.580384695; Fold-change:-0.053020814; Z-score:-0.480242398
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5A80 Ovarian dysfunction Click to Show/Hide the Full List
The Studied Tissue Vastus lateralis muscle
The Specified Disease Polycystic ovary syndrome [ICD-11:5A80.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.891113302; Fold-change:-0.010168907; Z-score:-0.060625309
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C51 Inborn carbohydrate metabolism disorder Click to Show/Hide the Full List
The Studied Tissue Biceps muscle
The Specified Disease Pompe disease [ICD-11:5C51.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.788661172; Fold-change:0.080478535; Z-score:0.267668525
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C56 Lysosomal disease Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Batten disease [ICD-11:5C56.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.216073763; Fold-change:0.106894353; Z-score:0.927335279
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 5C80 Hyperlipoproteinaemia Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.164247924; Fold-change:0.014010494; Z-score:0.095562917
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Familial hypercholesterolemia [ICD-11:5C80.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000931866; Fold-change:-0.124160666; Z-score:-0.540345359
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374898118; Fold-change:0.070302542; Z-score:0.302717609
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.911906935; Fold-change:0.008910482; Z-score:0.043758645
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.470270529; Fold-change:-0.021828431; Z-score:-0.240710071
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.090912547; Fold-change:-0.085146063; Z-score:-0.597892282
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.209080168; Fold-change:0.053487203; Z-score:0.346172136
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.348039823; Fold-change:-0.003988929; Z-score:-0.028636225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374898118; Fold-change:0.070302542; Z-score:0.302717609
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.911906935; Fold-change:0.008910482; Z-score:0.043758645
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.470270529; Fold-change:-0.021828431; Z-score:-0.240710071
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.090912547; Fold-change:-0.085146063; Z-score:-0.597892282
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.209080168; Fold-change:0.053487203; Z-score:0.346172136
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.348039823; Fold-change:-0.003988929; Z-score:-0.028636225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374898118; Fold-change:0.070302542; Z-score:0.302717609
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.911906935; Fold-change:0.008910482; Z-score:0.043758645
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.470270529; Fold-change:-0.021828431; Z-score:-0.240710071
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.090912547; Fold-change:-0.085146063; Z-score:-0.597892282
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.209080168; Fold-change:0.053487203; Z-score:0.346172136
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.348039823; Fold-change:-0.003988929; Z-score:-0.028636225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374898118; Fold-change:0.070302542; Z-score:0.302717609
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.911906935; Fold-change:0.008910482; Z-score:0.043758645
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.470270529; Fold-change:-0.021828431; Z-score:-0.240710071
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.090912547; Fold-change:-0.085146063; Z-score:-0.597892282
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.209080168; Fold-change:0.053487203; Z-score:0.346172136
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.348039823; Fold-change:-0.003988929; Z-score:-0.028636225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 06 Mental, behavioural or neurodevelopmental disorder
             [+] ICD-11: 6A02 Autism spectrum disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Autism [ICD-11:6A02]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374898118; Fold-change:0.070302542; Z-score:0.302717609
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A20 Schizophrenia Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.911906935; Fold-change:0.008910482; Z-score:0.043758645
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Superior temporal cortex
The Specified Disease Schizophrenia [ICD-11:6A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.470270529; Fold-change:-0.021828431; Z-score:-0.240710071
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A60 Bipolar disorder Click to Show/Hide the Full List
The Studied Tissue Prefrontal cortex
The Specified Disease Bipolar disorder [ICD-11:6A60-6A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.090912547; Fold-change:-0.085146063; Z-score:-0.597892282
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 6A70 Depressive disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.209080168; Fold-change:0.053487203; Z-score:0.346172136
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Prefrontal cortex
The Specified Disease Major depressive disorder [ICD-11:6A70-6A7Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.348039823; Fold-change:-0.003988929; Z-score:-0.028636225
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.7075995; Fold-change:0.164055967; Z-score:0.557693562
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.756541881; Fold-change:-0.09453014; Z-score:-0.947962272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524717875; Fold-change:-0.024896889; Z-score:-0.135359174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150313909; Fold-change:-0.066762106; Z-score:-0.292016643
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.427542608; Fold-change:0.037080253; Z-score:0.139759962
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.476995471; Fold-change:-0.127219993; Z-score:-0.701514469
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.157525185; Fold-change:0.12263365; Z-score:0.568307074
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.639581234; Fold-change:0.04122894; Z-score:0.170214988
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374116444; Fold-change:0.114914877; Z-score:0.458139816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000412724; Fold-change:0.151254897; Z-score:1.064547052
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.656895242; Fold-change:-0.023989155; Z-score:-0.163666748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.272861736; Fold-change:0.190403921; Z-score:0.905275142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009709087; Fold-change:0.110037355; Z-score:0.888062623
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004259934; Fold-change:-0.190347347; Z-score:-1.696604066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002145585; Fold-change:-0.178784992; Z-score:-1.411890889
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.7075995; Fold-change:0.164055967; Z-score:0.557693562
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.756541881; Fold-change:-0.09453014; Z-score:-0.947962272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524717875; Fold-change:-0.024896889; Z-score:-0.135359174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150313909; Fold-change:-0.066762106; Z-score:-0.292016643
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.427542608; Fold-change:0.037080253; Z-score:0.139759962
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.476995471; Fold-change:-0.127219993; Z-score:-0.701514469
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.157525185; Fold-change:0.12263365; Z-score:0.568307074
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.639581234; Fold-change:0.04122894; Z-score:0.170214988
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374116444; Fold-change:0.114914877; Z-score:0.458139816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000412724; Fold-change:0.151254897; Z-score:1.064547052
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.656895242; Fold-change:-0.023989155; Z-score:-0.163666748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.272861736; Fold-change:0.190403921; Z-score:0.905275142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009709087; Fold-change:0.110037355; Z-score:0.888062623
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004259934; Fold-change:-0.190347347; Z-score:-1.696604066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002145585; Fold-change:-0.178784992; Z-score:-1.411890889
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.7075995; Fold-change:0.164055967; Z-score:0.557693562
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.756541881; Fold-change:-0.09453014; Z-score:-0.947962272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524717875; Fold-change:-0.024896889; Z-score:-0.135359174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150313909; Fold-change:-0.066762106; Z-score:-0.292016643
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.427542608; Fold-change:0.037080253; Z-score:0.139759962
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.476995471; Fold-change:-0.127219993; Z-score:-0.701514469
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.157525185; Fold-change:0.12263365; Z-score:0.568307074
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.639581234; Fold-change:0.04122894; Z-score:0.170214988
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374116444; Fold-change:0.114914877; Z-score:0.458139816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000412724; Fold-change:0.151254897; Z-score:1.064547052
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.656895242; Fold-change:-0.023989155; Z-score:-0.163666748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.272861736; Fold-change:0.190403921; Z-score:0.905275142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009709087; Fold-change:0.110037355; Z-score:0.888062623
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004259934; Fold-change:-0.190347347; Z-score:-1.696604066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002145585; Fold-change:-0.178784992; Z-score:-1.411890889
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.7075995; Fold-change:0.164055967; Z-score:0.557693562
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.756541881; Fold-change:-0.09453014; Z-score:-0.947962272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524717875; Fold-change:-0.024896889; Z-score:-0.135359174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150313909; Fold-change:-0.066762106; Z-score:-0.292016643
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.427542608; Fold-change:0.037080253; Z-score:0.139759962
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.476995471; Fold-change:-0.127219993; Z-score:-0.701514469
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.157525185; Fold-change:0.12263365; Z-score:0.568307074
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.639581234; Fold-change:0.04122894; Z-score:0.170214988
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374116444; Fold-change:0.114914877; Z-score:0.458139816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000412724; Fold-change:0.151254897; Z-score:1.064547052
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.656895242; Fold-change:-0.023989155; Z-score:-0.163666748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.272861736; Fold-change:0.190403921; Z-score:0.905275142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009709087; Fold-change:0.110037355; Z-score:0.888062623
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004259934; Fold-change:-0.190347347; Z-score:-1.696604066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002145585; Fold-change:-0.178784992; Z-score:-1.411890889
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.7075995; Fold-change:0.164055967; Z-score:0.557693562
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.756541881; Fold-change:-0.09453014; Z-score:-0.947962272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524717875; Fold-change:-0.024896889; Z-score:-0.135359174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150313909; Fold-change:-0.066762106; Z-score:-0.292016643
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.427542608; Fold-change:0.037080253; Z-score:0.139759962
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.476995471; Fold-change:-0.127219993; Z-score:-0.701514469
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.157525185; Fold-change:0.12263365; Z-score:0.568307074
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.639581234; Fold-change:0.04122894; Z-score:0.170214988
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374116444; Fold-change:0.114914877; Z-score:0.458139816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000412724; Fold-change:0.151254897; Z-score:1.064547052
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.656895242; Fold-change:-0.023989155; Z-score:-0.163666748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.272861736; Fold-change:0.190403921; Z-score:0.905275142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009709087; Fold-change:0.110037355; Z-score:0.888062623
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004259934; Fold-change:-0.190347347; Z-score:-1.696604066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002145585; Fold-change:-0.178784992; Z-score:-1.411890889
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.7075995; Fold-change:0.164055967; Z-score:0.557693562
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.756541881; Fold-change:-0.09453014; Z-score:-0.947962272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524717875; Fold-change:-0.024896889; Z-score:-0.135359174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150313909; Fold-change:-0.066762106; Z-score:-0.292016643
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.427542608; Fold-change:0.037080253; Z-score:0.139759962
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.476995471; Fold-change:-0.127219993; Z-score:-0.701514469
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.157525185; Fold-change:0.12263365; Z-score:0.568307074
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.639581234; Fold-change:0.04122894; Z-score:0.170214988
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374116444; Fold-change:0.114914877; Z-score:0.458139816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000412724; Fold-change:0.151254897; Z-score:1.064547052
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.656895242; Fold-change:-0.023989155; Z-score:-0.163666748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.272861736; Fold-change:0.190403921; Z-score:0.905275142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009709087; Fold-change:0.110037355; Z-score:0.888062623
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004259934; Fold-change:-0.190347347; Z-score:-1.696604066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002145585; Fold-change:-0.178784992; Z-score:-1.411890889
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.7075995; Fold-change:0.164055967; Z-score:0.557693562
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.756541881; Fold-change:-0.09453014; Z-score:-0.947962272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524717875; Fold-change:-0.024896889; Z-score:-0.135359174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150313909; Fold-change:-0.066762106; Z-score:-0.292016643
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.427542608; Fold-change:0.037080253; Z-score:0.139759962
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.476995471; Fold-change:-0.127219993; Z-score:-0.701514469
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.157525185; Fold-change:0.12263365; Z-score:0.568307074
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.639581234; Fold-change:0.04122894; Z-score:0.170214988
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374116444; Fold-change:0.114914877; Z-score:0.458139816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000412724; Fold-change:0.151254897; Z-score:1.064547052
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.656895242; Fold-change:-0.023989155; Z-score:-0.163666748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.272861736; Fold-change:0.190403921; Z-score:0.905275142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009709087; Fold-change:0.110037355; Z-score:0.888062623
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004259934; Fold-change:-0.190347347; Z-score:-1.696604066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002145585; Fold-change:-0.178784992; Z-score:-1.411890889
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.7075995; Fold-change:0.164055967; Z-score:0.557693562
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.756541881; Fold-change:-0.09453014; Z-score:-0.947962272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524717875; Fold-change:-0.024896889; Z-score:-0.135359174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150313909; Fold-change:-0.066762106; Z-score:-0.292016643
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.427542608; Fold-change:0.037080253; Z-score:0.139759962
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.476995471; Fold-change:-0.127219993; Z-score:-0.701514469
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.157525185; Fold-change:0.12263365; Z-score:0.568307074
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.639581234; Fold-change:0.04122894; Z-score:0.170214988
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374116444; Fold-change:0.114914877; Z-score:0.458139816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000412724; Fold-change:0.151254897; Z-score:1.064547052
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.656895242; Fold-change:-0.023989155; Z-score:-0.163666748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.272861736; Fold-change:0.190403921; Z-score:0.905275142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009709087; Fold-change:0.110037355; Z-score:0.888062623
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004259934; Fold-change:-0.190347347; Z-score:-1.696604066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002145585; Fold-change:-0.178784992; Z-score:-1.411890889
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.7075995; Fold-change:0.164055967; Z-score:0.557693562
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.756541881; Fold-change:-0.09453014; Z-score:-0.947962272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524717875; Fold-change:-0.024896889; Z-score:-0.135359174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150313909; Fold-change:-0.066762106; Z-score:-0.292016643
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.427542608; Fold-change:0.037080253; Z-score:0.139759962
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.476995471; Fold-change:-0.127219993; Z-score:-0.701514469
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.157525185; Fold-change:0.12263365; Z-score:0.568307074
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.639581234; Fold-change:0.04122894; Z-score:0.170214988
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374116444; Fold-change:0.114914877; Z-score:0.458139816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000412724; Fold-change:0.151254897; Z-score:1.064547052
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.656895242; Fold-change:-0.023989155; Z-score:-0.163666748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.272861736; Fold-change:0.190403921; Z-score:0.905275142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009709087; Fold-change:0.110037355; Z-score:0.888062623
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004259934; Fold-change:-0.190347347; Z-score:-1.696604066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002145585; Fold-change:-0.178784992; Z-score:-1.411890889
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.7075995; Fold-change:0.164055967; Z-score:0.557693562
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.756541881; Fold-change:-0.09453014; Z-score:-0.947962272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524717875; Fold-change:-0.024896889; Z-score:-0.135359174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150313909; Fold-change:-0.066762106; Z-score:-0.292016643
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.427542608; Fold-change:0.037080253; Z-score:0.139759962
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.476995471; Fold-change:-0.127219993; Z-score:-0.701514469
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.157525185; Fold-change:0.12263365; Z-score:0.568307074
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.639581234; Fold-change:0.04122894; Z-score:0.170214988
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374116444; Fold-change:0.114914877; Z-score:0.458139816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000412724; Fold-change:0.151254897; Z-score:1.064547052
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.656895242; Fold-change:-0.023989155; Z-score:-0.163666748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.272861736; Fold-change:0.190403921; Z-score:0.905275142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009709087; Fold-change:0.110037355; Z-score:0.888062623
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004259934; Fold-change:-0.190347347; Z-score:-1.696604066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002145585; Fold-change:-0.178784992; Z-score:-1.411890889
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.7075995; Fold-change:0.164055967; Z-score:0.557693562
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.756541881; Fold-change:-0.09453014; Z-score:-0.947962272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524717875; Fold-change:-0.024896889; Z-score:-0.135359174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150313909; Fold-change:-0.066762106; Z-score:-0.292016643
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.427542608; Fold-change:0.037080253; Z-score:0.139759962
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.476995471; Fold-change:-0.127219993; Z-score:-0.701514469
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.157525185; Fold-change:0.12263365; Z-score:0.568307074
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.639581234; Fold-change:0.04122894; Z-score:0.170214988
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374116444; Fold-change:0.114914877; Z-score:0.458139816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000412724; Fold-change:0.151254897; Z-score:1.064547052
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.656895242; Fold-change:-0.023989155; Z-score:-0.163666748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.272861736; Fold-change:0.190403921; Z-score:0.905275142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009709087; Fold-change:0.110037355; Z-score:0.888062623
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004259934; Fold-change:-0.190347347; Z-score:-1.696604066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002145585; Fold-change:-0.178784992; Z-score:-1.411890889
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.7075995; Fold-change:0.164055967; Z-score:0.557693562
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.756541881; Fold-change:-0.09453014; Z-score:-0.947962272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524717875; Fold-change:-0.024896889; Z-score:-0.135359174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150313909; Fold-change:-0.066762106; Z-score:-0.292016643
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.427542608; Fold-change:0.037080253; Z-score:0.139759962
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.476995471; Fold-change:-0.127219993; Z-score:-0.701514469
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.157525185; Fold-change:0.12263365; Z-score:0.568307074
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.639581234; Fold-change:0.04122894; Z-score:0.170214988
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374116444; Fold-change:0.114914877; Z-score:0.458139816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000412724; Fold-change:0.151254897; Z-score:1.064547052
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.656895242; Fold-change:-0.023989155; Z-score:-0.163666748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.272861736; Fold-change:0.190403921; Z-score:0.905275142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009709087; Fold-change:0.110037355; Z-score:0.888062623
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004259934; Fold-change:-0.190347347; Z-score:-1.696604066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002145585; Fold-change:-0.178784992; Z-score:-1.411890889
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 08 Disease of the nervous system
             [+] ICD-11: 8A00 Parkinsonism Click to Show/Hide the Full List
The Studied Tissue Substantia nigra tissue
The Specified Disease Parkinson's disease [ICD-11:8A00.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.7075995; Fold-change:0.164055967; Z-score:0.557693562
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A01 Choreiform disorder Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Huntington's disease [ICD-11:8A01.10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.756541881; Fold-change:-0.09453014; Z-score:-0.947962272
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A20 Alzheimer disease Click to Show/Hide the Full List
The Studied Tissue Entorhinal cortex
The Specified Disease Alzheimer's disease [ICD-11:8A20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.524717875; Fold-change:-0.024896889; Z-score:-0.135359174
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A2Y Neurocognitive impairment Click to Show/Hide the Full List
The Studied Tissue White matter tissue
The Specified Disease HIV-associated neurocognitive impairment [ICD-11:8A2Y-8A2Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.150313909; Fold-change:-0.066762106; Z-score:-0.292016643
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A40 Multiple sclerosis Click to Show/Hide the Full List
The Studied Tissue Plasmacytoid dendritic cells
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.427542608; Fold-change:0.037080253; Z-score:0.139759962
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Spinal cord
The Specified Disease Multiple sclerosis [ICD-11:8A40]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.476995471; Fold-change:-0.127219993; Z-score:-0.701514469
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8A60 Epilepsy Click to Show/Hide the Full List
The Studied Tissue Peritumoral cortex tissue
The Specified Disease Epilepsy [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Other Disease Section p-value:0.157525185; Fold-change:0.12263365; Z-score:0.568307074
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Whole blood
The Specified Disease Seizure [ICD-11:8A60-8A6Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.639581234; Fold-change:0.04122894; Z-score:0.170214988
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B01 Subarachnoid haemorrhage Click to Show/Hide the Full List
The Studied Tissue Intracranial artery
The Specified Disease Intracranial aneurysm [ICD-11:8B01.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.374116444; Fold-change:0.114914877; Z-score:0.458139816
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B11 Cerebral ischaemic stroke Click to Show/Hide the Full List
The Studied Tissue Whole blood
The Specified Disease Cardioembolic stroke [ICD-11:8B11.20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.000412724; Fold-change:0.151254897; Z-score:1.064547052
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Peripheral blood
The Specified Disease Ischemic stroke [ICD-11:8B11]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.656895242; Fold-change:-0.023989155; Z-score:-0.163666748
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8B60 Motor neuron disease Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.272861736; Fold-change:0.190403921; Z-score:0.905275142
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Cervical spinal cord
The Specified Disease Lateral sclerosis [ICD-11:8B60.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.009709087; Fold-change:0.110037355; Z-score:0.888062623
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C70 Muscular dystrophy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Myopathy [ICD-11:8C70.6]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.004259934; Fold-change:-0.190347347; Z-score:-1.696604066
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: 8C75 Distal myopathy Click to Show/Hide the Full List
The Studied Tissue Muscle tissue
The Specified Disease Tibial muscular dystrophy [ICD-11:8C75]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.002145585; Fold-change:-0.178784992; Z-score:-1.411890889
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 09 Disease of the visual system
             [+] ICD-11: 9A96 Anterior uveitis Click to Show/Hide the Full List
The Studied Tissue Peripheral monocyte
The Specified Disease Autoimmune uveitis [ICD-11:9A96]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.003056542; Fold-change:-0.277143642; Z-score:-2.449028271
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050699444; Fold-change:0.392975958; Z-score:0.92633566
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.359030594; Fold-change:-0.21059537; Z-score:-0.852218579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.873964787; Fold-change:0.03940924; Z-score:0.060924957
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050699444; Fold-change:0.392975958; Z-score:0.92633566
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.359030594; Fold-change:-0.21059537; Z-score:-0.852218579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.873964787; Fold-change:0.03940924; Z-score:0.060924957
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 11 Disease of the circulatory system
             [+] ICD-11: BA41 Myocardial infarction Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction [ICD-11:BA41-BA50]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.050699444; Fold-change:0.392975958; Z-score:0.92633566
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BA80 Coronary artery disease Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease [ICD-11:BA80-BA8Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.359030594; Fold-change:-0.21059537; Z-score:-0.852218579
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: BB70 Aortic valve stenosis Click to Show/Hide the Full List
The Studied Tissue Calcified aortic valve
The Specified Disease Aortic stenosis [ICD-11:BB70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.873964787; Fold-change:0.03940924; Z-score:0.060924957
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.468171957; Fold-change:-0.065561234; Z-score:-0.416338838
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036580879; Fold-change:0.335495133; Z-score:1.807262892
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.103167009; Fold-change:0.097383244; Z-score:0.924345614
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.207114809; Fold-change:0.081305747; Z-score:0.358484157
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.155169621; Fold-change:0.119455822; Z-score:0.665798913
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.661397068; Fold-change:0.027901832; Z-score:0.111953609
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.843067669; Fold-change:0.004776785; Z-score:0.053070832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.468171957; Fold-change:-0.065561234; Z-score:-0.416338838
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036580879; Fold-change:0.335495133; Z-score:1.807262892
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.103167009; Fold-change:0.097383244; Z-score:0.924345614
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.207114809; Fold-change:0.081305747; Z-score:0.358484157
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.155169621; Fold-change:0.119455822; Z-score:0.665798913
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.661397068; Fold-change:0.027901832; Z-score:0.111953609
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.843067669; Fold-change:0.004776785; Z-score:0.053070832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.468171957; Fold-change:-0.065561234; Z-score:-0.416338838
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036580879; Fold-change:0.335495133; Z-score:1.807262892
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.103167009; Fold-change:0.097383244; Z-score:0.924345614
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.207114809; Fold-change:0.081305747; Z-score:0.358484157
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.155169621; Fold-change:0.119455822; Z-score:0.665798913
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.661397068; Fold-change:0.027901832; Z-score:0.111953609
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.843067669; Fold-change:0.004776785; Z-score:0.053070832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.468171957; Fold-change:-0.065561234; Z-score:-0.416338838
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036580879; Fold-change:0.335495133; Z-score:1.807262892
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.103167009; Fold-change:0.097383244; Z-score:0.924345614
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.207114809; Fold-change:0.081305747; Z-score:0.358484157
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.155169621; Fold-change:0.119455822; Z-score:0.665798913
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.661397068; Fold-change:0.027901832; Z-score:0.111953609
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.843067669; Fold-change:0.004776785; Z-score:0.053070832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.468171957; Fold-change:-0.065561234; Z-score:-0.416338838
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036580879; Fold-change:0.335495133; Z-score:1.807262892
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.103167009; Fold-change:0.097383244; Z-score:0.924345614
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.207114809; Fold-change:0.081305747; Z-score:0.358484157
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.155169621; Fold-change:0.119455822; Z-score:0.665798913
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.661397068; Fold-change:0.027901832; Z-score:0.111953609
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.843067669; Fold-change:0.004776785; Z-score:0.053070832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 12 Disease of the respiratory system
             [+] ICD-11: 7A40 Central sleep apnoea Click to Show/Hide the Full List
The Studied Tissue Hyperplastic tonsil
The Specified Disease Apnea [ICD-11:7A40]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.468171957; Fold-change:-0.065561234; Z-score:-0.416338838
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA08 Vasomotor or allergic rhinitis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Olive pollen allergy [ICD-11:CA08.00]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.036580879; Fold-change:0.335495133; Z-score:1.807262892
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA0A Chronic rhinosinusitis Click to Show/Hide the Full List
The Studied Tissue Sinus mucosa tissue
The Specified Disease Chronic rhinosinusitis [ICD-11:CA0A]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.103167009; Fold-change:0.097383244; Z-score:0.924345614
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA22 Chronic obstructive pulmonary disease Click to Show/Hide the Full List
The Studied Tissue Small airway epithelium
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.207114809; Fold-change:0.081305747; Z-score:0.358484157
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Lung tissue
The Specified Disease Chronic obstructive pulmonary disease [ICD-11:CA22]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.155169621; Fold-change:0.119455822; Z-score:0.665798913
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CA23 Asthma Click to Show/Hide the Full List
The Studied Tissue Nasal and bronchial airway
The Specified Disease Asthma [ICD-11:CA23]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.661397068; Fold-change:0.027901832; Z-score:0.111953609
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: CB03 Idiopathic interstitial pneumonitis Click to Show/Hide the Full List
The Studied Tissue Lung tissue
The Specified Disease Idiopathic pulmonary fibrosis [ICD-11:CB03.4]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.843067669; Fold-change:0.004776785; Z-score:0.053070832
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.56E-05; Fold-change:0.155984714; Z-score:0.652673938
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.337616545; Fold-change:0.056579765; Z-score:0.515492837
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.509905289; Fold-change:-0.001537292; Z-score:-0.011242844
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.148582242; Fold-change:0.131556754; Z-score:0.545974457
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.386486137; Fold-change:0.024619874; Z-score:0.07493051
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.601842152; Fold-change:-0.010946877; Z-score:-0.057686811
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.56E-05; Fold-change:0.155984714; Z-score:0.652673938
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.337616545; Fold-change:0.056579765; Z-score:0.515492837
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.509905289; Fold-change:-0.001537292; Z-score:-0.011242844
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.148582242; Fold-change:0.131556754; Z-score:0.545974457
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.386486137; Fold-change:0.024619874; Z-score:0.07493051
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.601842152; Fold-change:-0.010946877; Z-score:-0.057686811
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.56E-05; Fold-change:0.155984714; Z-score:0.652673938
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.337616545; Fold-change:0.056579765; Z-score:0.515492837
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.509905289; Fold-change:-0.001537292; Z-score:-0.011242844
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.148582242; Fold-change:0.131556754; Z-score:0.545974457
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.386486137; Fold-change:0.024619874; Z-score:0.07493051
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.601842152; Fold-change:-0.010946877; Z-score:-0.057686811
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.56E-05; Fold-change:0.155984714; Z-score:0.652673938
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.337616545; Fold-change:0.056579765; Z-score:0.515492837
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.509905289; Fold-change:-0.001537292; Z-score:-0.011242844
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.148582242; Fold-change:0.131556754; Z-score:0.545974457
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.386486137; Fold-change:0.024619874; Z-score:0.07493051
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.601842152; Fold-change:-0.010946877; Z-score:-0.057686811
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.56E-05; Fold-change:0.155984714; Z-score:0.652673938
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.337616545; Fold-change:0.056579765; Z-score:0.515492837
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.509905289; Fold-change:-0.001537292; Z-score:-0.011242844
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.148582242; Fold-change:0.131556754; Z-score:0.545974457
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.386486137; Fold-change:0.024619874; Z-score:0.07493051
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.601842152; Fold-change:-0.010946877; Z-score:-0.057686811
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 13 Disease of the digestive system
             [+] ICD-11: DA0C Periodontal disease Click to Show/Hide the Full List
The Studied Tissue Gingival tissue
The Specified Disease Periodontal disease [ICD-11:DA0C]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:6.56E-05; Fold-change:0.155984714; Z-score:0.652673938
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DA42 Gastritis Click to Show/Hide the Full List
The Studied Tissue Gastric antrum tissue
The Specified Disease Eosinophilic gastritis [ICD-11:DA42.2]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.337616545; Fold-change:0.056579765; Z-score:0.515492837
TF expression in the diseased tissue of patients
TF expression in the normal tissue adjacent to the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB92 Non-alcoholic fatty liver disease Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Non-alcoholic fatty liver disease [ICD-11:DB92]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.509905289; Fold-change:-0.001537292; Z-score:-0.011242844
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DB99 Hepatic failure Click to Show/Hide the Full List
The Studied Tissue Liver tissue
The Specified Disease Liver failure [ICD-11:DB99.7-DB99.8]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.148582242; Fold-change:0.131556754; Z-score:0.545974457
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD71 Ulcerative colitis Click to Show/Hide the Full List
The Studied Tissue Colon mucosal tissue
The Specified Disease Ulcerative colitis [ICD-11:DD71]
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:0.386486137; Fold-change:0.024619874; Z-score:0.07493051
TF expression in the diseased tissue of patients
TF expression in tissue other than the diseased tissue of patients
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: DD91 Irritable bowel syndrome Click to Show/Hide the Full List
The Studied Tissue Rectal colon tissue
The Specified Disease Irritable bowel syndrome [ICD-11:DD91.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.601842152; Fold-change:-0.010946877; Z-score:-0.057686811
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001588307; Fold-change:0.244132191; Z-score:1.337665414
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.237947686; Fold-change:0.021849893; Z-score:0.061676198
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.79E-47; Fold-change:0.647608285; Z-score:2.739609576
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.268639174; Fold-change:-0.207820042; Z-score:-0.985654476
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.531171475; Fold-change:0.00363835; Z-score:0.013338941
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.386470646; Fold-change:0.078519907; Z-score:0.358038602
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001588307; Fold-change:0.244132191; Z-score:1.337665414
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.237947686; Fold-change:0.021849893; Z-score:0.061676198
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.79E-47; Fold-change:0.647608285; Z-score:2.739609576
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.268639174; Fold-change:-0.207820042; Z-score:-0.985654476
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.531171475; Fold-change:0.00363835; Z-score:0.013338941
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.386470646; Fold-change:0.078519907; Z-score:0.358038602
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001588307; Fold-change:0.244132191; Z-score:1.337665414
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.237947686; Fold-change:0.021849893; Z-score:0.061676198
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.79E-47; Fold-change:0.647608285; Z-score:2.739609576
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.268639174; Fold-change:-0.207820042; Z-score:-0.985654476
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.531171475; Fold-change:0.00363835; Z-score:0.013338941
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.386470646; Fold-change:0.078519907; Z-score:0.358038602
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001588307; Fold-change:0.244132191; Z-score:1.337665414
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.237947686; Fold-change:0.021849893; Z-score:0.061676198
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.79E-47; Fold-change:0.647608285; Z-score:2.739609576
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.268639174; Fold-change:-0.207820042; Z-score:-0.985654476
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.531171475; Fold-change:0.00363835; Z-score:0.013338941
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.386470646; Fold-change:0.078519907; Z-score:0.358038602
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 14 Disease of the skin
             [+] ICD-11: EA80 Atopic eczema Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Atopic dermatitis [ICD-11:EA80]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.001588307; Fold-change:0.244132191; Z-score:1.337665414
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EA90 Psoriasis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Psoriasis [ICD-11:EA90]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.237947686; Fold-change:0.021849893; Z-score:0.061676198
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value:3.79E-47; Fold-change:0.647608285; Z-score:2.739609576
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED63 Acquired hypomelanotic disorder Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Vitiligo [ICD-11:ED63.0]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.268639174; Fold-change:-0.207820042; Z-score:-0.985654476
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: ED70 Alopecia or hair loss Click to Show/Hide the Full List
The Studied Tissue Skin from scalp
The Specified Disease Alopecia [ICD-11:ED70]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.531171475; Fold-change:0.00363835; Z-score:0.013338941
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: EK0Z Contact dermatitis Click to Show/Hide the Full List
The Studied Tissue Skin
The Specified Disease Sensitive skin [ICD-11:EK0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.386470646; Fold-change:0.078519907; Z-score:0.358038602
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.070718028; Fold-change:0.121071977; Z-score:0.781698495
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.331190881; Fold-change:-0.164054516; Z-score:-0.536198749
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.103405753; Fold-change:-0.212461313; Z-score:-0.688835182
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.28E-07; Fold-change:0.143590391; Z-score:0.690794191
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.985848391; Fold-change:-0.018794899; Z-score:-0.187909362
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.645419783; Fold-change:0.214010587; Z-score:0.538754951
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.070718028; Fold-change:0.121071977; Z-score:0.781698495
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.331190881; Fold-change:-0.164054516; Z-score:-0.536198749
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.103405753; Fold-change:-0.212461313; Z-score:-0.688835182
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.28E-07; Fold-change:0.143590391; Z-score:0.690794191
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.985848391; Fold-change:-0.018794899; Z-score:-0.187909362
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.645419783; Fold-change:0.214010587; Z-score:0.538754951
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.070718028; Fold-change:0.121071977; Z-score:0.781698495
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.331190881; Fold-change:-0.164054516; Z-score:-0.536198749
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.103405753; Fold-change:-0.212461313; Z-score:-0.688835182
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.28E-07; Fold-change:0.143590391; Z-score:0.690794191
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.985848391; Fold-change:-0.018794899; Z-score:-0.187909362
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.645419783; Fold-change:0.214010587; Z-score:0.538754951
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.070718028; Fold-change:0.121071977; Z-score:0.781698495
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.331190881; Fold-change:-0.164054516; Z-score:-0.536198749
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.103405753; Fold-change:-0.212461313; Z-score:-0.688835182
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.28E-07; Fold-change:0.143590391; Z-score:0.690794191
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.985848391; Fold-change:-0.018794899; Z-score:-0.187909362
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.645419783; Fold-change:0.214010587; Z-score:0.538754951
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.070718028; Fold-change:0.121071977; Z-score:0.781698495
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.331190881; Fold-change:-0.164054516; Z-score:-0.536198749
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.103405753; Fold-change:-0.212461313; Z-score:-0.688835182
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.28E-07; Fold-change:0.143590391; Z-score:0.690794191
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.985848391; Fold-change:-0.018794899; Z-score:-0.187909362
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.645419783; Fold-change:0.214010587; Z-score:0.538754951
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 15 Disease of the musculoskeletal system/connective tissue
             [+] ICD-11: FA00 Osteoarthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Arthropathy [ICD-11:FA00-FA5Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.070718028; Fold-change:0.121071977; Z-score:0.781698495
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
The Studied Tissue Synovial tissue
The Specified Disease Osteoarthritis [ICD-11:FA00-FA0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.331190881; Fold-change:-0.164054516; Z-score:-0.536198749
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA20 Rheumatoid arthritis Click to Show/Hide the Full List
The Studied Tissue Synovial tissue
The Specified Disease Rheumatoid arthritis [ICD-11:FA20]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.103405753; Fold-change:-0.212461313; Z-score:-0.688835182
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA24 Juvenile idiopathic arthritis Click to Show/Hide the Full List
The Studied Tissue Peripheral blood
The Specified Disease Juvenile idiopathic arthritis [ICD-11:FA24]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:2.28E-07; Fold-change:0.143590391; Z-score:0.690794191
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FA92 Inflammatory spondyloarthritis Click to Show/Hide the Full List
The Studied Tissue Pheripheral blood
The Specified Disease Ankylosing spondylitis [ICD-11:FA92.0Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.985848391; Fold-change:-0.018794899; Z-score:-0.187909362
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: FB83 Low bone mass disorder Click to Show/Hide the Full List
The Studied Tissue Bone marrow
The Specified Disease Osteoporosis [ICD-11:FB83.1]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.645419783; Fold-change:0.214010587; Z-score:0.538754951
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 16 Disease of the genitourinary system
             [+] ICD-11: GA10 Endometriosis Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.577290725; Fold-change:0.098573297; Z-score:0.098347313
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: GC00 Cystitis Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.305390913; Fold-change:0.088020568; Z-score:0.789255459
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 16 Disease of the genitourinary system
             [+] ICD-11: GA10 Endometriosis Click to Show/Hide the Full List
The Studied Tissue Endometrium tissue
The Specified Disease Endometriosis [ICD-11:GA10]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.577290725; Fold-change:0.098573297; Z-score:0.098347313
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: GC00 Cystitis Click to Show/Hide the Full List
The Studied Tissue Bladder tissue
The Specified Disease Interstitial cystitis [ICD-11:GC00.3]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.305390913; Fold-change:0.088020568; Z-score:0.789255459
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 19 Certain condition originating in the perinatal period
             [+] ICD-11: KA21 Short gestation disorder Click to Show/Hide the Full List
The Studied Tissue Myometrium
The Specified Disease Preterm birth [ICD-11:KA21.4Z]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.39901207; Fold-change:-0.118440798; Z-score:-0.551269955
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 20 Developmental anomaly
             [+] ICD-11: LD2C Overgrowth syndrome Click to Show/Hide the Full List
The Studied Tissue Adipose tissue
The Specified Disease Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.54502448; Fold-change:0.070256548; Z-score:0.812324222
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Perituberal tissue
The Specified Disease Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.058383281; Fold-change:0.394511688; Z-score:2.587916736
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
ICD-11: 20 Developmental anomaly
             [+] ICD-11: LD2C Overgrowth syndrome Click to Show/Hide the Full List
The Studied Tissue Adipose tissue
The Specified Disease Simpson golabi behmel syndrome [ICD-11:LD2C]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.54502448; Fold-change:0.070256548; Z-score:0.812324222
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
             [+] ICD-11: LD2D Phakomatoses/hamartoneoplastic syndrome Click to Show/Hide the Full List
The Studied Tissue Perituberal tissue
The Specified Disease Tuberous sclerosis complex [ICD-11:LD2D.2]
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value:0.058383281; Fold-change:0.394511688; Z-score:2.587916736
TF expression in the diseased tissue of patients
TF expression in the normal tissue of healthy individuals
Please Click the above Thumbnail to View/Download
the Expression Barchart for All Samples
References
1 Brain-derived neurotrophic factor promotes vesicular glutamate transporter 3 expression and neurite outgrowth of dorsal root ganglion neurons through the activation of the transcription factors Etv4 and Etv5. Brain Res Bull. 2016 Mar;121:215-26.

If you find any error in data or bug in web service, please kindly report it to Dr. Li and Dr. Fu.